Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01252
Gene name
Locationscaffold_01:4497931..4501710
Strand+
Gene length (bp)3779
Transcript length (bp)3666
Coding sequence length (bp)3666
Protein length (aa) 1222

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07919 Gryzun Gryzun, putative trafficking through Golgi 3.7E-204 627 1203
PF11817 Foie-gras_1 Foie gras liver health family 1 3.4E-84 324 600
PF12742 Gryzun-like Gryzun, putative Golgi trafficking 2.1E-04 1127 1172

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6127 0.3863 0.2857 0.1022 0.1145 0.0483 0.2174 0.3296 0.4558 0.0043

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2621
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|740
Ophiocordyceps australis map64 (Brazil) OphauB2|442
Ophiocordyceps camponoti-floridani Ophcf2|01252 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3238
Ophiocordyceps kimflemingae Ophio5|2198
Ophiocordyceps subramaniannii Hirsu2|4000

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01252
MDGYPAGCLDHNVPLLVASGLNAQQEADEWQVEQGLRDGSVLLRSSLPLLDERLAAFLAKYFAQVNAHGLSWTGV
SRKEPFHFRVKTVARTFVLPPRRARLPESVEPLPSATLHSPYSPLSPASALYPDGLIDAQWIRKHQELVPAIYAC
FYTLTNDTQLKADINELKSALARSGYKTRIVAILLGDAGSSVQERLENIRKGTALDPKSIYYIPARSPASEVKRT
LDSILSALYSTAVEYYRDLGRHARKKRSRGIAPQPTVPPTTGTSRTLSLPDWNFRYDFKAAILADFRQELDAANR
SFEQAYEILLGQDVLDIMPSWSPRWNEGRLLADVIAIRCVRIQLWMGNTSLAVRRWQSHRDRIGDVVDRRGRGTS
NYGWQAWEARWAVVMAQLMERVGLAGLAPASMQLSLPPDKAVLGERLKPWELLHHTGYWYRLAARHLAARRTLAL
TIPDDVRRAPDASPDASSPSSPKPQSTGKAYVYDTYLCPAPYREYPLHGPGVNHAQLIIDCLLAARSQFQTRGQN
RLAAEVALECAREMASIAAWEDVLSLLQPLWTAAAYRSEGWVLAAEELCWLLRRAAAETGRASLVIAVDWELMHR
KYSRRSRWHYDLAKSLQGVTSDSKPTVSLCDDAAPAFVTASFAFRTKESKAGDKCLAQLLLHSAAMPGSAAVTLS
SLQLKLTGSLKTIVIEHEEAASTAEAPIDALTLEEIFSGTAEEIESPTHLRGRCDLTLRPGQRRVLEAVIPLREA
GTAEATSVTLFVDNDSFHLDYTIKFRVTDGAVGWYTGTGAARDVRPDARFLQVQSRPPKMGIDVPDGARQFYTDE
ALELMVDIGNDEDEAASVKLAVNVTGDQRPRFNVIVDGQEHSSGQEETGGTTGIPLGTIDSGSSRRLMIRIDPVA
APTSHEMQLRVSYHLESDAATSIVQEAVTQLSVVTPFEANYDLIPRLHAEPWPSLFDAEGVVVDREAGISDGPAK
GLAQKWCLDCDFASFVAEDLLVLSVDVKMAPLVSGARCRVTRRPQMPEDGIVAAPKTMHKADFDLEVHKLSLDDR
DPVPLTPGLVIGWRRVKSADHGPVNTTTLPAGQYLVLGTEPRVLASVLHETRKTWPDLMWLEVTIENPSSHFLTF
GLSMEPSDEFAMSGAKQTTLHLLPLSRRTLRYRLLPLVRGTYIRPGLVVRDKYFQKVLHIMPTEGMKTDKDGLLV
WVPEAATDPETDPEASRGRQG*
Coding >Ophcf2|01252
ATGGATGGCTATCCGGCGGGCTGCCTGGATCACAACGTCCCCCTTCTCGTCGCCTCGGGTCTAAACGCCCAACAA
GAAGCGGATGAATGGCAGGTCGAGCAAGGGCTTCGAGACGGGAGCGTGCTTCTCAGATCGTCGCTTCCGCTGCTG
GATGAGAGGCTTGCGGCCTTTTTGGCCAAGTACTTTGCGCAGGTCAACGCCCATGGCTTATCCTGGACGGGCGTT
TCGCGAAAGGAGCCCTTTCACTTTCGCGTCAAGACTGTCGCCAGGACATTCGTACTGCCTCCTCGAAGAGCCCGG
CTACCAGAGTCGGTCGAACCGCTACCGTCGGCGACGCTGCATTCACCCTATTCGCCGCTGTCTCCCGCCTCTGCG
TTGTACCCCGACGGTCTCATAGATGCGCAATGGATCAGGAAGCATCAAGAGCTGGTTCCCGCAATCTACGCCTGC
TTCTACACCTTGACCAACGACACTCAGCTGAAAGCAGACATCAACGAACTGAAAAGTGCACTGGCAAGATCCGGA
TACAAGACGAGAATCGTGGCCATCCTGCTCGGTGATGCCGGTAGCAGCGTACAGGAGCGTCTCGAGAACATCCGA
AAGGGCACCGCGCTGGATCCCAAGTCCATCTATTACATCCCCGCCAGGAGTCCAGCGTCGGAGGTCAAGCGAACC
TTGGACTCCATCCTCTCTGCCCTATACAGCACCGCTGTCGAATACTATCGAGATCTGGGACGGCATGCTAGGAAG
AAGCGGTCCCGCGGGATAGCTCCGCAGCCGACGGTACCGCCGACGACGGGCACTTCGCGCACGCTGTCGCTGCCG
GACTGGAACTTTCGATACGACTTCAAAGCCGCCATATTGGCCGATTTTCGCCAAGAACTGGATGCAGCGAACCGT
TCGTTCGAGCAAGCCTACGAGATCCTGTTGGGCCAGGATGTCCTCGACATCATGCCTAGCTGGAGCCCCCGCTGG
AACGAAGGCCGGCTTCTGGCAGACGTCATTGCCATCCGCTGCGTGCGCATCCAGCTGTGGATGGGAAATACGAGC
CTGGCCGTCCGGCGATGGCAGAGTCATCGTGACCGCATCGGTGACGTCGTCGACCGGCGAGGGCGTGGCACCAGC
AACTACGGATGGCAGGCCTGGGAGGCAAGATGGGCCGTCGTAATGGCGCAGCTGATGGAACGCGTCGGCCTTGCT
GGTCTGGCGCCCGCGTCCATGCAGCTCTCCTTACCGCCGGACAAGGCGGTTCTGGGCGAGCGGCTGAAGCCGTGG
GAGTTGCTGCACCATACGGGATATTGGTATCGCCTGGCCGCCCGGCATCTCGCCGCGCGAAGGACGCTGGCGCTC
ACGATCCCCGACGATGTCCGGCGCGCGCCAGATGCCTCGCCGGATGCGTCGTCACCGTCTTCGCCGAAGCCGCAG
TCGACCGGCAAGGCTTACGTCTATGACACCTATCTCTGTCCCGCGCCCTACCGAGAATATCCGCTTCACGGCCCG
GGCGTCAACCACGCACAGCTCATCATCGACTGCCTGCTCGCTGCCCGTTCTCAATTCCAGACTCGTGGCCAGAAT
CGGTTGGCTGCCGAGGTGGCCCTGGAATGCGCCCGCGAGATGGCATCGATAGCAGCGTGGGAAGATGTGCTTTCT
CTGCTCCAGCCGCTATGGACTGCCGCGGCCTACCGATCTGAAGGCTGGGTTCTTGCTGCCGAGGAGCTCTGCTGG
CTGCTGAGACGGGCTGCCGCCGAGACCGGACGCGCCAGCCTCGTCATCGCCGTCGACTGGGAGCTCATGCACCGG
AAGTACTCGCGGCGAAGTCGGTGGCACTACGATCTCGCAAAGTCTCTCCAAGGCGTCACCAGCGATTCCAAGCCG
ACCGTCAGCCTTTGCGATGATGCCGCTCCCGCCTTTGTTACCGCCAGCTTCGCCTTCCGGACCAAGGAGAGCAAG
GCGGGCGACAAGTGTTTGGCTCAGCTGCTTCTTCACTCTGCAGCGATGCCGGGCTCCGCAGCCGTGACCTTGTCG
TCTTTGCAGCTGAAACTGACGGGAAGCCTCAAGACCATCGTCATCGAACACGAGGAGGCGGCATCGACCGCCGAA
GCCCCGATCGACGCACTGACGCTGGAAGAGATATTCTCCGGGACGGCGGAGGAGATCGAATCGCCAACCCATCTG
AGAGGCCGGTGCGATCTGACCCTAAGACCCGGTCAGAGACGGGTTCTGGAGGCGGTAATCCCGCTGCGAGAAGCT
GGGACGGCTGAGGCGACCTCGGTGACGCTCTTCGTCGACAATGACAGCTTCCATCTCGACTACACAATCAAGTTT
CGCGTCACGGACGGTGCGGTGGGATGGTATACCGGTACAGGAGCTGCACGAGATGTGCGACCCGATGCCCGCTTC
CTGCAGGTGCAGTCTCGGCCACCCAAGATGGGCATCGACGTACCTGATGGCGCGCGCCAATTCTACACTGACGAG
GCGCTAGAGCTGATGGTCGACATTGGCAACGACGAGGACGAGGCAGCCAGCGTCAAGCTGGCCGTCAATGTCACC
GGAGACCAGCGGCCGCGGTTCAACGTCATTGTCGACGGTCAGGAGCACAGCAGCGGCCAGGAAGAAACAGGTGGC
ACGACAGGCATCCCGCTCGGCACCATCGACAGCGGATCGTCACGCCGGCTAATGATCCGGATCGATCCGGTGGCG
GCTCCGACATCACACGAGATGCAGCTGCGGGTTTCGTATCACCTCGAGTCGGACGCGGCAACGTCCATCGTTCAA
GAGGCGGTGACGCAGCTAAGCGTGGTAACTCCATTCGAGGCCAATTATGATCTTATCCCGCGACTTCACGCCGAG
CCGTGGCCGAGCCTATTCGACGCCGAAGGTGTCGTCGTGGACCGGGAAGCAGGAATCTCGGACGGTCCGGCCAAG
GGCCTCGCGCAGAAATGGTGTCTAGACTGCGACTTTGCCTCTTTTGTGGCCGAGGATCTGCTGGTGCTGAGCGTG
GACGTGAAGATGGCTCCGTTGGTGAGCGGTGCGCGCTGCCGCGTCACCAGACGGCCGCAGATGCCCGAGGATGGC
ATCGTGGCGGCGCCCAAGACAATGCACAAAGCCGACTTTGACCTAGAGGTGCACAAGCTCAGCCTCGACGACAGG
GACCCGGTTCCCCTGACGCCGGGTCTGGTCATCGGCTGGCGGCGAGTCAAGAGCGCGGACCATGGGCCGGTGAAC
ACGACGACGCTGCCGGCGGGCCAGTATCTGGTGCTGGGGACGGAACCGCGGGTGTTGGCTTCGGTGCTGCACGAG
ACGCGGAAGACGTGGCCGGACCTCATGTGGTTGGAGGTGACGATCGAGAACCCGTCCAGTCACTTCCTCACGTTT
GGGCTGTCGATGGAGCCGAGCGACGAGTTCGCCATGTCAGGCGCAAAGCAGACGACGCTTCACCTGCTGCCCCTT
TCGCGGAGGACATTGCGCTACCGGCTGCTGCCGCTTGTCCGCGGCACCTACATCCGCCCGGGGCTGGTGGTGCGG
GACAAGTATTTCCAGAAGGTGCTGCACATCATGCCGACCGAAGGGATGAAGACGGACAAGGACGGGCTGCTGGTG
TGGGTGCCGGAGGCCGCAACAGACCCGGAGACTGACCCTGAAGCGTCACGGGGAAGACAAGGATGA
Transcript >Ophcf2|01252
ATGGATGGCTATCCGGCGGGCTGCCTGGATCACAACGTCCCCCTTCTCGTCGCCTCGGGTCTAAACGCCCAACAA
GAAGCGGATGAATGGCAGGTCGAGCAAGGGCTTCGAGACGGGAGCGTGCTTCTCAGATCGTCGCTTCCGCTGCTG
GATGAGAGGCTTGCGGCCTTTTTGGCCAAGTACTTTGCGCAGGTCAACGCCCATGGCTTATCCTGGACGGGCGTT
TCGCGAAAGGAGCCCTTTCACTTTCGCGTCAAGACTGTCGCCAGGACATTCGTACTGCCTCCTCGAAGAGCCCGG
CTACCAGAGTCGGTCGAACCGCTACCGTCGGCGACGCTGCATTCACCCTATTCGCCGCTGTCTCCCGCCTCTGCG
TTGTACCCCGACGGTCTCATAGATGCGCAATGGATCAGGAAGCATCAAGAGCTGGTTCCCGCAATCTACGCCTGC
TTCTACACCTTGACCAACGACACTCAGCTGAAAGCAGACATCAACGAACTGAAAAGTGCACTGGCAAGATCCGGA
TACAAGACGAGAATCGTGGCCATCCTGCTCGGTGATGCCGGTAGCAGCGTACAGGAGCGTCTCGAGAACATCCGA
AAGGGCACCGCGCTGGATCCCAAGTCCATCTATTACATCCCCGCCAGGAGTCCAGCGTCGGAGGTCAAGCGAACC
TTGGACTCCATCCTCTCTGCCCTATACAGCACCGCTGTCGAATACTATCGAGATCTGGGACGGCATGCTAGGAAG
AAGCGGTCCCGCGGGATAGCTCCGCAGCCGACGGTACCGCCGACGACGGGCACTTCGCGCACGCTGTCGCTGCCG
GACTGGAACTTTCGATACGACTTCAAAGCCGCCATATTGGCCGATTTTCGCCAAGAACTGGATGCAGCGAACCGT
TCGTTCGAGCAAGCCTACGAGATCCTGTTGGGCCAGGATGTCCTCGACATCATGCCTAGCTGGAGCCCCCGCTGG
AACGAAGGCCGGCTTCTGGCAGACGTCATTGCCATCCGCTGCGTGCGCATCCAGCTGTGGATGGGAAATACGAGC
CTGGCCGTCCGGCGATGGCAGAGTCATCGTGACCGCATCGGTGACGTCGTCGACCGGCGAGGGCGTGGCACCAGC
AACTACGGATGGCAGGCCTGGGAGGCAAGATGGGCCGTCGTAATGGCGCAGCTGATGGAACGCGTCGGCCTTGCT
GGTCTGGCGCCCGCGTCCATGCAGCTCTCCTTACCGCCGGACAAGGCGGTTCTGGGCGAGCGGCTGAAGCCGTGG
GAGTTGCTGCACCATACGGGATATTGGTATCGCCTGGCCGCCCGGCATCTCGCCGCGCGAAGGACGCTGGCGCTC
ACGATCCCCGACGATGTCCGGCGCGCGCCAGATGCCTCGCCGGATGCGTCGTCACCGTCTTCGCCGAAGCCGCAG
TCGACCGGCAAGGCTTACGTCTATGACACCTATCTCTGTCCCGCGCCCTACCGAGAATATCCGCTTCACGGCCCG
GGCGTCAACCACGCACAGCTCATCATCGACTGCCTGCTCGCTGCCCGTTCTCAATTCCAGACTCGTGGCCAGAAT
CGGTTGGCTGCCGAGGTGGCCCTGGAATGCGCCCGCGAGATGGCATCGATAGCAGCGTGGGAAGATGTGCTTTCT
CTGCTCCAGCCGCTATGGACTGCCGCGGCCTACCGATCTGAAGGCTGGGTTCTTGCTGCCGAGGAGCTCTGCTGG
CTGCTGAGACGGGCTGCCGCCGAGACCGGACGCGCCAGCCTCGTCATCGCCGTCGACTGGGAGCTCATGCACCGG
AAGTACTCGCGGCGAAGTCGGTGGCACTACGATCTCGCAAAGTCTCTCCAAGGCGTCACCAGCGATTCCAAGCCG
ACCGTCAGCCTTTGCGATGATGCCGCTCCCGCCTTTGTTACCGCCAGCTTCGCCTTCCGGACCAAGGAGAGCAAG
GCGGGCGACAAGTGTTTGGCTCAGCTGCTTCTTCACTCTGCAGCGATGCCGGGCTCCGCAGCCGTGACCTTGTCG
TCTTTGCAGCTGAAACTGACGGGAAGCCTCAAGACCATCGTCATCGAACACGAGGAGGCGGCATCGACCGCCGAA
GCCCCGATCGACGCACTGACGCTGGAAGAGATATTCTCCGGGACGGCGGAGGAGATCGAATCGCCAACCCATCTG
AGAGGCCGGTGCGATCTGACCCTAAGACCCGGTCAGAGACGGGTTCTGGAGGCGGTAATCCCGCTGCGAGAAGCT
GGGACGGCTGAGGCGACCTCGGTGACGCTCTTCGTCGACAATGACAGCTTCCATCTCGACTACACAATCAAGTTT
CGCGTCACGGACGGTGCGGTGGGATGGTATACCGGTACAGGAGCTGCACGAGATGTGCGACCCGATGCCCGCTTC
CTGCAGGTGCAGTCTCGGCCACCCAAGATGGGCATCGACGTACCTGATGGCGCGCGCCAATTCTACACTGACGAG
GCGCTAGAGCTGATGGTCGACATTGGCAACGACGAGGACGAGGCAGCCAGCGTCAAGCTGGCCGTCAATGTCACC
GGAGACCAGCGGCCGCGGTTCAACGTCATTGTCGACGGTCAGGAGCACAGCAGCGGCCAGGAAGAAACAGGTGGC
ACGACAGGCATCCCGCTCGGCACCATCGACAGCGGATCGTCACGCCGGCTAATGATCCGGATCGATCCGGTGGCG
GCTCCGACATCACACGAGATGCAGCTGCGGGTTTCGTATCACCTCGAGTCGGACGCGGCAACGTCCATCGTTCAA
GAGGCGGTGACGCAGCTAAGCGTGGTAACTCCATTCGAGGCCAATTATGATCTTATCCCGCGACTTCACGCCGAG
CCGTGGCCGAGCCTATTCGACGCCGAAGGTGTCGTCGTGGACCGGGAAGCAGGAATCTCGGACGGTCCGGCCAAG
GGCCTCGCGCAGAAATGGTGTCTAGACTGCGACTTTGCCTCTTTTGTGGCCGAGGATCTGCTGGTGCTGAGCGTG
GACGTGAAGATGGCTCCGTTGGTGAGCGGTGCGCGCTGCCGCGTCACCAGACGGCCGCAGATGCCCGAGGATGGC
ATCGTGGCGGCGCCCAAGACAATGCACAAAGCCGACTTTGACCTAGAGGTGCACAAGCTCAGCCTCGACGACAGG
GACCCGGTTCCCCTGACGCCGGGTCTGGTCATCGGCTGGCGGCGAGTCAAGAGCGCGGACCATGGGCCGGTGAAC
ACGACGACGCTGCCGGCGGGCCAGTATCTGGTGCTGGGGACGGAACCGCGGGTGTTGGCTTCGGTGCTGCACGAG
ACGCGGAAGACGTGGCCGGACCTCATGTGGTTGGAGGTGACGATCGAGAACCCGTCCAGTCACTTCCTCACGTTT
GGGCTGTCGATGGAGCCGAGCGACGAGTTCGCCATGTCAGGCGCAAAGCAGACGACGCTTCACCTGCTGCCCCTT
TCGCGGAGGACATTGCGCTACCGGCTGCTGCCGCTTGTCCGCGGCACCTACATCCGCCCGGGGCTGGTGGTGCGG
GACAAGTATTTCCAGAAGGTGCTGCACATCATGCCGACCGAAGGGATGAAGACGGACAAGGACGGGCTGCTGGTG
TGGGTGCCGGAGGCCGCAACAGACCCGGAGACTGACCCTGAAGCGTCACGGGGAAGACAAGGATGA
Gene >Ophcf2|01252
ATGGATGGCTATCCGGCGGGCTGCCTGGATCACAACGTCCCCCTTCTCGTCGCCTCGGGTCTAAACGCCCAACAA
GAAGCGGATGAATGGCAGGTCGAGCAAGGGCTTCGAGACGGGAGCGTGCTTCTCAGATCGTCGCTTCCGCTGCTG
GATGAGAGGCTTGCGGCCTTTTTGGCCAAGTACTTTGCGCAGGTCAACGCCCATGGCTTATCCTGGACGGGCGTT
TCGCGAAAGGAGCCCTTTCACTTTCGCGTCAAGACTGTCGCCAGGGTATGATGTCTCACAGAAGCGTGCCTTGGG
CTGGCTCGCGCTGAAAGATGGCTCTTTAGACATTCGTACTGCCTCCTCGAAGAGCCCGGCTACCAGAGTCGGTCG
AACCGCTACCGTCGGCGACGCTGCATTCACCCTATTCGCCGCTGTCTCCCGCCTCTGCGTTGTACCCCGACGGTC
TCATAGATGCGCAATGGATCAGGAAGCATCAAGAGCTGGTTCCCGCAATCTACGCCTGCTTCTACACCTTGACCA
ACGACACTCAGCTGAAAGCAGACATCAACGAACTGAAAAGTGCACTGGCAAGATCCGGATACAAGACGAGAATCG
TGGCCATCCTGCTCGGTGATGCCGGTAGCAGCGTACAGGAGCGTCTCGAGAACATCCGAAAGGGCACCGCGCTGG
ATCCCAAGTCCATCTATTACATCCCCGCCAGGAGTCCAGCGTCGGAGGTCAAGCGAACCTTGGACTCCATCCTCT
CTGCCCTATACAGCACCGCTGTCGAATACTATCGAGATCTGGGACGGCATGCTAGGAAGAAGCGGTCCCGCGGGA
TAGCTCCGCAGCCGACGGTACCGCCGACGACGGGCACTTCGCGCACGCTGTCGCTGCCGGACTGGAACTTTCGAT
ACGACTTCAAAGCCGCCATATTGGCCGATTTTCGCCAAGAACTGGATGCAGCGAACCGTTCGTTCGAGCAAGCCT
ACGAGATCCTGTTGGGCCAGGATGTCCTCGACATCATGCCTAGCTGGAGCCCCCGCTGGAACGAAGGCCGGCTTC
TGGCAGACGTCATTGCCATCCGCTGCGTGCGCATCCAGCTGTGGATGGGAAATACGAGCCTGGCCGTCCGGCGAT
GGCAGAGTCATCGTGACCGCATCGGTGACGTCGTCGACCGGCGAGGGCGTGGCACCAGCAACTACGGATGGCAGG
CCTGGGAGGCAAGATGGGCCGTCGTAATGGCGCAGCTGATGGAACGCGTCGGCCTTGCTGGTCTGGCGCCCGCGT
CCATGCAGCTCTCCTTACCGCCGGACAAGGCGGTTCTGGGCGAGCGGCTGAAGCCGTGGGAGTTGCTGCACCATA
CGGGATATTGGTATCGCCTGGCCGCCCGGCATCTCGCCGCGCGAAGGACGCTGGCGCTCACGATCCCCGACGATG
TCCGGCGCGCGCCAGATGCCTCGCCGGATGCGTCGTCACCGTCTTCGCCGAAGCCGCAGTCGACCGGCAAGGCTT
ACGTCTATGACACCTATCTCTGTCCCGCGCCCTACCGAGAATATCCGCTTCACGGCCCGGGCGTCAACCACGCAC
AGCTCATCATCGACTGCCTGCTCGCTGCCCGTTCTCAATTCCAGACTCGTGGCCAGAATCGGTTGGCTGCCGAGG
TGGCCCTGGAATGCGCCCGCGAGATGGCATCGATAGCAGCGTGGGAAGATGTGCTTTCTCTGCTCCAGCCGCTAT
GGACTGCCGCGGCCTACCGATCTGAAGGCTGGGTTCTTGCTGCCGAGGAGCTCTGCTGGCTGCTGAGACGGGCTG
CCGCCGAGACCGGACGCGCCAGCCTCGTCATCGCCGTCGACTGGGAGCTCATGCACCGGAGTATGTCCATCGAGG
GGAACAGGGAGTTCTCGTAACTGACGCTTAATTGTTTAGAGTACTCGCGGCGAAGTCGGTGGCACTACGATCTCG
CAAAGTCTCTCCAAGGCGTCACCAGCGATTCCAAGCCGACCGTCAGCCTTTGCGATGATGCCGCTCCCGCCTTTG
TTACCGCCAGCTTCGCCTTCCGGACCAAGGAGAGCAAGGCGGGCGACAAGTGTTTGGCTCAGCTGCTTCTTCACT
CTGCAGCGATGCCGGGCTCCGCAGCCGTGACCTTGTCGTCTTTGCAGCTGAAACTGACGGGAAGCCTCAAGACCA
TCGTCATCGAACACGAGGAGGCGGCATCGACCGCCGAAGCCCCGATCGACGCACTGACGCTGGAAGAGATATTCT
CCGGGACGGCGGAGGAGATCGAATCGCCAACCCATCTGAGAGGCCGGTGCGATCTGACCCTAAGACCCGGTCAGA
GACGGGTTCTGGAGGCGGTAATCCCGCTGCGAGAAGCTGGGACGGCTGAGGCGACCTCGGTGACGCTCTTCGTCG
ACAATGACAGCTTCCATCTCGACTACACAATCAAGTTTCGCGTCACGGACGGTGCGGTGGGATGGTATACCGGTA
CAGGAGCTGCACGAGATGTGCGACCCGATGCCCGCTTCCTGCAGGTGCAGTCTCGGCCACCCAAGATGGGCATCG
ACGTACCTGATGGCGCGCGCCAATTCTACACTGACGAGGCGCTAGAGCTGATGGTCGACATTGGCAACGACGAGG
ACGAGGCAGCCAGCGTCAAGCTGGCCGTCAATGTCACCGGAGACCAGCGGCCGCGGTTCAACGTCATTGTCGACG
GTCAGGAGCACAGCAGCGGCCAGGAAGAAACAGGTGGCACGACAGGCATCCCGCTCGGCACCATCGACAGCGGAT
CGTCACGCCGGCTAATGATCCGGATCGATCCGGTGGCGGCTCCGACATCACACGAGATGCAGCTGCGGGTTTCGT
ATCACCTCGAGTCGGACGCGGCAACGTCCATCGTTCAAGAGGCGGTGACGCAGCTAAGCGTGGTAACTCCATTCG
AGGCCAATTATGATCTTATCCCGCGACTTCACGCCGAGCCGTGGCCGAGCCTATTCGACGCCGAAGGTGTCGTCG
TGGACCGGGAAGCAGGAATCTCGGACGGTCCGGCCAAGGGCCTCGCGCAGAAATGGTGTCTAGACTGCGACTTTG
CCTCTTTTGTGGCCGAGGATCTGCTGGTGCTGAGCGTGGACGTGAAGATGGCTCCGTTGGTGAGCGGTGCGCGCT
GCCGCGTCACCAGACGGCCGCAGATGCCCGAGGATGGCATCGTGGCGGCGCCCAAGACAATGCACAAAGCCGACT
TTGACCTAGAGGTGCACAAGCTCAGCCTCGACGACAGGGACCCGGTTCCCCTGACGCCGGGTCTGGTCATCGGCT
GGCGGCGAGTCAAGAGCGCGGACCATGGGCCGGTGAACACGACGACGCTGCCGGCGGGCCAGTATCTGGTGCTGG
GGACGGAACCGCGGGTGTTGGCTTCGGTGCTGCACGAGACGCGGAAGACGTGGCCGGACCTCATGTGGTTGGAGG
TGACGATCGAGAACCCGTCCAGTCACTTCCTCACGTTTGGGCTGTCGATGGAGCCGAGCGACGAGTTCGCCATGT
CAGGCGCAAAGCAGACGACGCTTCACCTGCTGCCCCTTTCGCGGAGGACATTGCGCTACCGGCTGCTGCCGCTTG
TCCGCGGCACCTACATCCGCCCGGGGCTGGTGGTGCGGGACAAGTATTTCCAGAAGGTGCTGCACATCATGCCGA
CCGAAGGGATGAAGACGGACAAGGACGGGCTGCTGGTGTGGGTGCCGGAGGCCGCAACAGACCCGGAGACTGACC
CTGAAGCGTCACGGGGAAGACAAGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail