Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01251
Gene name
Locationscaffold_01:4497073..4497448
Strand-
Gene length (bp)375
Transcript length (bp)312
Coding sequence length (bp)312
Protein length (aa) 104

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09809 MRP-L27 Mitochondrial ribosomal protein L27 1.2E-16 13 74

GO

GO Term Description Terminal node
GO:0005762 mitochondrial large ribosomal subunit Yes
GO:0003735 structural constituent of ribosome Yes
GO:0005575 cellular_component No
GO:1990904 ribonucleoprotein complex No
GO:0005198 structural molecule activity No
GO:0000315 organellar large ribosomal subunit No
GO:0015934 large ribosomal subunit No
GO:0032991 protein-containing complex No
GO:0044391 ribosomal subunit No
GO:0098798 mitochondrial protein-containing complex No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1456 0.2449 0.0217 0.0994 0.9545 0.0387 0.0253 0.0345 0.014 0.0061

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2622
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|739
Ophiocordyceps australis map64 (Brazil) OphauB2|443
Ophiocordyceps camponoti-floridani Ophcf2|01251 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3239
Ophiocordyceps kimflemingae Ophio5|2199
Ophiocordyceps subramaniannii Hirsu2|4001

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01251
MRPTQALLVGRYRHLRLTTKDVGKGYYKGNRTGSMGRHTKYGGYQIDWAKVRTYVVPNLKSFKLTPFVTQEVMPV
PGEYKGVELGPQSPHLYLEQWKRYNGVD*
Coding >Ophcf2|01251
ATGAGGCCAACACAGGCCCTCCTCGTCGGGCGCTACCGCCACCTCCGGCTGACAACCAAGGACGTCGGCAAGGGC
TACTACAAGGGCAACCGGACGGGTTCCATGGGCCGCCACACCAAATACGGAGGCTATCAGATTGACTGGGCAAAG
GTGCGCACGTACGTGGTGCCTAACCTCAAGTCTTTCAAGCTTACGCCTTTCGTTACGCAAGAGGTTATGCCGGTG
CCTGGAGAGTATAAGGGGGTGGAATTGGGGCCGCAGAGTCCGCACCTTTATCTGGAGCAGTGGAAGAGATACAAT
GGTGTTGATTGA
Transcript >Ophcf2|01251
ATGAGGCCAACACAGGCCCTCCTCGTCGGGCGCTACCGCCACCTCCGGCTGACAACCAAGGACGTCGGCAAGGGC
TACTACAAGGGCAACCGGACGGGTTCCATGGGCCGCCACACCAAATACGGAGGCTATCAGATTGACTGGGCAAAG
GTGCGCACGTACGTGGTGCCTAACCTCAAGTCTTTCAAGCTTACGCCTTTCGTTACGCAAGAGGTTATGCCGGTG
CCTGGAGAGTATAAGGGGGTGGAATTGGGGCCGCAGAGTCCGCACCTTTATCTGGAGCAGTGGAAGAGATACAAT
GGTGTTGATTGA
Gene >Ophcf2|01251
ATGAGGCCAACACAGGCCCTCCTCGTCGGGCGCTACCGCCACCTCCGGCTGACAACCAAGGACGTCGGCAAGGGC
TACTACAAGGGCAACCGGACGGGTTCCATGGGCCGCCACACCAAATACGGAGGCTATCAGATTGACTGGGCAAAG
GTGCGCACGTACGTGGTGCCTAACCTCAAGTCTTTCAAGGCAAGTTGAAGTTGACTCGAGGTGCGTTGTTGATGG
TTTTTTGTTCGCTGACGATGATGGTAGCTTACGCCTTTCGTTACGCAAGAGGTTATGCCGGTGCCTGGAGAGTAT
AAGGGGGTGGAATTGGGGCCGCAGAGTCCGCACCTTTATCTGGAGCAGTGGAAGAGATACAATGGTGTTGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail