Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01247
Gene name
Locationscaffold_01:4487312..4490674
Strand-
Gene length (bp)3362
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08601 PAP1 Transcription factor PAP1 6.1E-10 418 518
PF08601 PAP1 Transcription factor PAP1 3.6E-57 518 673
PF11034 Grg1 Glucose-repressible protein Grg1 2.4E-28 1 66
PF00170 bZIP_1 bZIP transcription factor 5.1E-08 296 345

GO

GO Term Description Terminal node
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003674 molecular_function No
GO:0050794 regulation of cellular process No
GO:0080090 regulation of primary metabolic process No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0031323 regulation of cellular metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0051252 regulation of RNA metabolic process No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0065007 biological regulation No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0008150 biological_process No
GO:0009889 regulation of biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2537 0.9609 0.1149 0.0285 0.0907 0.0029 0.0539 0.025 0.0277 0.0059

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
bZIP

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 85.25 47.38 123.11
Alive In ants, during behavior modification 409.35 157.62 661.09
Dead In ants, recently dead 271.86 123.72 419.99

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.062299 no
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup776
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|734
Ophiocordyceps australis map64 (Brazil) OphauB2|448
Ophiocordyceps camponoti-floridani Ophcf2|01247 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3244
Ophiocordyceps kimflemingae Ophio5|2204
Ophiocordyceps subramaniannii Hirsu2|285
Ophiocordyceps subramaniannii Hirsu2|4006

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01247
MESAKQAVNYVSESIQGAASGVSKEANKEVAKDSNVNIGTRASAAKDALSDKVSETTHDNKAEAHKNSGCYDRHP
RGCHHIDQLPGNVFLPSITVEAATGSPRPPQSLREPIFAFFVFEILSSIGCGGGEGNPSPCSRACFAMPPAETDS
GSRPANNFLLTPHQQNLLFAALSTNGQSAALGASGSVSLSPTSFQSSPLRSLDGGPRYHERPYLDDFGDSSFDFS
FDSLDQPRTANDASATVKSDSTEADATEKRNHPDDEETGDSPGHESKRHEGSEKGPKKPGRKPLTSEPTSKRKAQ
NRAAQRAFRERKEKHLKDLETKVTVLEKQSEAANHENSQLRLQLDAVTSELNHYKQRLATLTNSTKPATGDSLAL
GNSLFGAVPELNFPFEFPKFGSLATDKPSSSSSSSGAGAQNGHGVQRQRSMGGTTSPKSVRPSTHDDHGRYPSIA
SSRASLDSVNMGFGGATSSPSASSISNAGGPVSSCGTSPEPSNHSPMGFKPLETLTTIGEEQPGVVTASHVSTGH
FNSVDAQTANFDWLASQNGGQFDPQLFGDYREPQENVLSGANLDEFFNDALDADFLTPYNVPMTAPTTGPRRNLI
DEIDAEQNALDDDVPKESNVRCHKIWDKLQGCPKAQSGEFDLDGLCSELTQKAKCSGHGPVVAERDFDSILRKYM
GKDVSPQCVATTLGIEVHPDGKPNGVAMP*
Coding >Ophcf2|01247
ATGGAGTCCGCCAAGCAAGCCGTCAACTACGTCTCTGAGTCGATTCAGGGTGCCGCCTCTGGCGTTAGCAAGGAA
GCCAACAAGGAGGTCGCCAAGGACAGCAACGTCAATATTGGCACTCGGGCGTCTGCTGCCAAGGATGCTCTCAGC
GACAAGGTCAGCGAGACGACGCACGATAACAAGGCCGAAGCCCACAAGAATTCCGGCTGTTACGATCGGCATCCG
CGGGGGTGCCACCACATTGATCAATTACCGGGAAACGTTTTCCTGCCGTCCATAACCGTTGAGGCCGCCACAGGC
TCTCCAAGACCGCCCCAGTCTCTCCGGGAACCCATCTTCGCCTTCTTTGTCTTTGAAATCCTGTCCTCCATTGGC
TGTGGTGGGGGGGAGGGAAATCCATCGCCTTGTTCACGCGCCTGTTTCGCGATGCCTCCCGCCGAGACAGACAGC
GGCTCCAGGCCGGCCAACAACTTTCTCTTGACCCCGCACCAGCAGAACCTGCTCTTTGCCGCTCTCAGCACCAAC
GGCCAGTCGGCTGCACTTGGGGCTTCGGGGTCCGTCTCCTTGTCACCGACATCGTTCCAGAGCTCGCCTCTGCGG
TCTCTCGACGGCGGTCCTCGCTATCACGAGAGACCTTACCTGGATGATTTCGGAGATTCGAGTTTCGACTTCTCC
TTCGACTCCTTGGATCAGCCACGAACGGCCAACGACGCCTCCGCCACCGTTAAGTCCGATTCGACCGAGGCTGAC
GCAACCGAGAAGCGGAATCACCCGGACGACGAAGAGACTGGCGATAGTCCCGGACACGAGTCAAAGCGCCATGAA
GGCTCTGAAAAGGGTCCCAAGAAGCCCGGCCGGAAGCCTCTGACTTCCGAGCCGACATCGAAACGCAAGGCTCAG
AACCGTGCTGCTCAGCGAGCATTTAGAGAGCGCAAGGAGAAGCACCTCAAGGACCTCGAGACCAAGGTCACCGTG
CTGGAGAAGCAGTCAGAGGCTGCCAATCATGAGAACAGCCAGCTGCGGCTGCAGCTCGACGCCGTCACCAGCGAG
CTCAACCATTATAAGCAGAGGCTGGCCACCCTGACCAATAGCACGAAGCCTGCCACGGGGGATAGCTTGGCCCTC
GGAAACTCCCTCTTCGGTGCCGTGCCCGAACTGAACTTTCCCTTTGAGTTTCCCAAGTTCGGCTCCCTGGCTACC
GACAAGCCTTCGTCGTCGTCGTCTTCGTCGGGCGCCGGCGCGCAAAATGGTCACGGCGTCCAGCGTCAGCGGAGC
ATGGGTGGTACGACGTCGCCGAAATCGGTGCGGCCGTCGACCCACGATGACCACGGCAGGTATCCATCCATCGCC
AGCTCTCGCGCCAGCCTCGATTCCGTCAACATGGGCTTTGGGGGGGCCACGAGCTCGCCATCGGCGTCATCAATT
TCCAACGCAGGAGGACCCGTATCTTCGTGCGGCACCTCGCCGGAGCCCTCAAACCACTCCCCAATGGGCTTTAAG
CCTCTCGAGACGTTGACGACCATCGGCGAGGAGCAGCCAGGCGTCGTGACGGCCAGCCACGTCTCAACAGGCCAC
TTTAATTCCGTCGACGCCCAGACAGCCAACTTTGACTGGCTGGCCAGCCAGAACGGGGGACAGTTCGACCCGCAG
CTGTTCGGTGACTACCGCGAGCCCCAGGAAAACGTCTTGTCCGGCGCCAACCTCGATGAGTTCTTCAACGACGCC
CTCGACGCAGATTTCCTCACGCCCTACAACGTGCCCATGACGGCGCCGACGACGGGCCCCAGGCGAAACCTCATC
GACGAAATTGACGCTGAGCAGAACGCGCTGGACGATGACGTACCCAAGGAGTCAAACGTCCGATGCCACAAGATC
TGGGACAAGCTACAGGGATGCCCCAAGGCACAGAGCGGCGAGTTCGATCTCGACGGCCTCTGCTCGGAGCTCACG
CAAAAGGCAAAGTGCTCCGGCCACGGGCCCGTCGTCGCAGAGCGAGACTTTGACTCCATCCTTCGCAAGTACATG
GGCAAGGACGTGTCGCCTCAGTGTGTCGCCACGACTCTTGGCATCGAGGTCCATCCCGATGGGAAGCCCAATGGC
GTGGCCATGCCCTAA
Transcript >Ophcf2|01247
ATGGAGTCCGCCAAGCAAGCCGTCAACTACGTCTCTGAGTCGATTCAGGGTGCCGCCTCTGGCGTTAGCAAGGAA
GCCAACAAGGAGGTCGCCAAGGACAGCAACGTCAATATTGGCACTCGGGCGTCTGCTGCCAAGGATGCTCTCAGC
GACAAGGTCAGCGAGACGACGCACGATAACAAGGCCGAAGCCCACAAGAATTCCGGCTGTTACGATCGGCATCCG
CGGGGGTGCCACCACATTGATCAATTACCGGGAAACGTTTTCCTGCCGTCCATAACCGTTGAGGCCGCCACAGGC
TCTCCAAGACCGCCCCAGTCTCTCCGGGAACCCATCTTCGCCTTCTTTGTCTTTGAAATCCTGTCCTCCATTGGC
TGTGGTGGGGGGGAGGGAAATCCATCGCCTTGTTCACGCGCCTGTTTCGCGATGCCTCCCGCCGAGACAGACAGC
GGCTCCAGGCCGGCCAACAACTTTCTCTTGACCCCGCACCAGCAGAACCTGCTCTTTGCCGCTCTCAGCACCAAC
GGCCAGTCGGCTGCACTTGGGGCTTCGGGGTCCGTCTCCTTGTCACCGACATCGTTCCAGAGCTCGCCTCTGCGG
TCTCTCGACGGCGGTCCTCGCTATCACGAGAGACCTTACCTGGATGATTTCGGAGATTCGAGTTTCGACTTCTCC
TTCGACTCCTTGGATCAGCCACGAACGGCCAACGACGCCTCCGCCACCGTTAAGTCCGATTCGACCGAGGCTGAC
GCAACCGAGAAGCGGAATCACCCGGACGACGAAGAGACTGGCGATAGTCCCGGACACGAGTCAAAGCGCCATGAA
GGCTCTGAAAAGGGTCCCAAGAAGCCCGGCCGGAAGCCTCTGACTTCCGAGCCGACATCGAAACGCAAGGCTCAG
AACCGTGCTGCTCAGCGAGCATTTAGAGAGCGCAAGGAGAAGCACCTCAAGGACCTCGAGACCAAGGTCACCGTG
CTGGAGAAGCAGTCAGAGGCTGCCAATCATGAGAACAGCCAGCTGCGGCTGCAGCTCGACGCCGTCACCAGCGAG
CTCAACCATTATAAGCAGAGGCTGGCCACCCTGACCAATAGCACGAAGCCTGCCACGGGGGATAGCTTGGCCCTC
GGAAACTCCCTCTTCGGTGCCGTGCCCGAACTGAACTTTCCCTTTGAGTTTCCCAAGTTCGGCTCCCTGGCTACC
GACAAGCCTTCGTCGTCGTCGTCTTCGTCGGGCGCCGGCGCGCAAAATGGTCACGGCGTCCAGCGTCAGCGGAGC
ATGGGTGGTACGACGTCGCCGAAATCGGTGCGGCCGTCGACCCACGATGACCACGGCAGGTATCCATCCATCGCC
AGCTCTCGCGCCAGCCTCGATTCCGTCAACATGGGCTTTGGGGGGGCCACGAGCTCGCCATCGGCGTCATCAATT
TCCAACGCAGGAGGACCCGTATCTTCGTGCGGCACCTCGCCGGAGCCCTCAAACCACTCCCCAATGGGCTTTAAG
CCTCTCGAGACGTTGACGACCATCGGCGAGGAGCAGCCAGGCGTCGTGACGGCCAGCCACGTCTCAACAGGCCAC
TTTAATTCCGTCGACGCCCAGACAGCCAACTTTGACTGGCTGGCCAGCCAGAACGGGGGACAGTTCGACCCGCAG
CTGTTCGGTGACTACCGCGAGCCCCAGGAAAACGTCTTGTCCGGCGCCAACCTCGATGAGTTCTTCAACGACGCC
CTCGACGCAGATTTCCTCACGCCCTACAACGTGCCCATGACGGCGCCGACGACGGGCCCCAGGCGAAACCTCATC
GACGAAATTGACGCTGAGCAGAACGCGCTGGACGATGACGTACCCAAGGAGTCAAACGTCCGATGCCACAAGATC
TGGGACAAGCTACAGGGATGCCCCAAGGCACAGAGCGGCGAGTTCGATCTCGACGGCCTCTGCTCGGAGCTCACG
CAAAAGGCAAAGTGCTCCGGCCACGGGCCCGTCGTCGCAGAGCGAGACTTTGACTCCATCCTTCGCAAGTACATG
GGCAAGGACGTGTCGCCTCAGTGTGTCGCCACGACTCTTGGCATCGAGGTCCATCCCGATGGGAAGCCCAATGGC
GTGGCCATGCCCTAA
Gene >Ophcf2|01247
ATGGAGTCCGCCAAGCAAGCCGTCAACTACGTCTCTGAGTCGATTCAGGGTGCCGCCTCTGGCGTTAGCAAGGAA
GCCAACAAGGAGGTCGCCAAGGACAGCAACGTCAATATTGGCACTCGGTAAGCAGCCTTGGCTGTGTTTTCTGCT
GGCGATAAGTCACTGACGCAAATCTTGATATAGGGCGTCTGCTGCCAAGGATGCTCTCAGCGACAAGGTCAGCGA
GACGACGCACGATAACAAGGCCGAAGCCCACAAGAAGTATGCGAAGGCTTAGACAGGGGTGATGACGACTACGAA
GACATGGCGCAAGAGCGGCTGGCGTAGAAGGGAACGATTGGCGTCGGACACCAAGTTATCGGTCTAATACCCTCC
CTCATCTTTGTCAGTGCCGAGCTTTTAGAACAGGTTGCTAGTAAACAAGAGCCTCTTTAAAATGCTACACGCATC
TGGTGATGGTTGCAGACGACATGCGCCTCGTTTTTGTGGGGGATAAGTTATTTTCAGAGGATGAAGCCGTGCACT
GATCGACAACAGACAACGTTCCCAATTATATGAAATGGTCAGATCGTGTTTTGCGAAGGGCGATGATGCCGGAGA
TGACGAGGGGTGCAGGGTAGGTTATATAGCACCCCGGTAGGCAGCGATAGGATGATGCGTGAACTGTGTCAGGGA
CCTGTTACAGCTGCCGTCTCGGGGGGCTTGCATTGTAGAGAGCTGGAACCGAACTGACCTGAGAATGGCACATAC
ATAGGTATGTATGTATGTGTGTGTGTGTGTATGTATGCTTGTGTATGTACATATGTATGACAGTATGAGGCATGT
AGGCGATGGAAGACGAGCTCCTCCTCATTAGACAAGGGCGTATCGCGCCAATCCATCCCCGCGGGGGACCGAAGG
CTCGATACCTACCTACCTAGCTGCCTACCTAGGTATATCGTACATACATATGTATGTGTGTACATACCTAGGTAT
GTGCATATACCTGACAAGGCTACCTAATGAGCGGGTGGTTTGCGGCAGAGAAAAGCCCCAAACCGGCTAAAGGAG
GACAACTCTCGCCTTATCGCACTGTGGTACCAATTCCTGCACGCGCACGCTTAATTCTTACGCGTTAAGCCCCTC
CTCCCTTGCGGCTTACAAATGCAGTTTGCCCCGACCATCTGACGATGGAATCCTGCTTTCAGTTCTCTGCATCTC
CATGATCCGTTCATCTATCCATCCATTCATCCGAGGACCAGTTCCGGCTGTTACGATCGGCATCCGCGGGGGTGC
CACCACATTGATCAATTACCGGGAAACGTTTTCCTGCCGTCCATAACCGTTGAGGCCGCCACAGGCTCTCCAAGA
CGTCAGTCAGCCCAACGGTTTTTTTTTTCTTTTCCTCCACGTGCGACTCATCGTCGCCTTTAGCGCCCCAGTCTC
TCCGGGAACCCATCTTCGCCTTCTTTGTCTTTGAAATCCTGTCCTCCATTGGCTGTGGTGGGGGGGAGGGAAATC
CATCGCCTTGTTCACGCGCCTGTTTCGCGATGCCTCCCGCCGAGACAGACAGCGGCTCCAGGCCGGCCAACAACT
TTCTCTTGACCCCGCACCAGCAGAACCTGCTCTTTGCCGCTCTCAGCACCAACGGCCAGTCGGCTGCACTTGGGG
CTTCGGGGTCCGTCTCCTTGTCACCGACATCGTTCCAGAGCTCGCCTCTGCGGTCTCTCGACGGCGGTCCTCGCT
ATCACGAGAGACCTTACCTGGATGATTTCGGAGATTCGAGTTTCGACTTCTCCTTCGACTCCTTGGATCAGCCAC
GAACGGCCAACGACGCCTCCGCCACCGTTAAGTCCGATTCGACCGAGGCTGACGCAACCGAGAAGCGGAATCACC
CGGACGACGAAGAGACTGGCGATAGTCCCGGACACGAGTCAAAGCGCCATGAAGGCTCTGAAAAGGGTCCCAAGA
AGCCCGGCCGGAAGCCTCTGACTTCCGAGCCGACATCGGTAAGGCTTGCTGACCCTCGTCGTGCGGCTTTGCTAA
ATAGCTACGGGGGGGGCCAGAAACGCAAGGCTCAGAACCGTGCTGCTCAGCGAGCATTTAGAGAGCGCAAGGAGA
AGCACCTCAAGGACCTCGAGACCAAGGTCACCGTGCTGGAGAAGCAGTCAGAGGCTGCCAATCATGAGAACAGCC
AGCTGCGGCTGCAGCTCGACGCCGTCACCAGCGAGCTCAACCATTATAAGCAGAGGCTGGCCACCCTGACCAATA
GCACGAAGCCTGCCACGGGGGATAGCTTGGCCCTCGGAAACTCCCTCTTCGGTGCCGTGCCCGAACTGAACTTTC
CCTTTGAGTTTCCCAAGTTCGGCTCCCTGGCTACCGACAAGCCTTCGTCGTCGTCGTCTTCGTCGGGCGCCGGCG
CGCAAAATGGTCACGGCGTCCAGCGTCAGCGGAGCATGGGTGGTACGACGTCGCCGAAATCGGTGCGGCCGTCGA
CCCACGATGACCACGGCAGGTATCCATCCATCGCCAGCTCTCGCGCCAGCCTCGATTCCGTCAACATGGGCTTTG
GGGGGGCCACGAGCTCGCCATCGGCGTCATCAATTTCCAACGCAGGAGGACCCGTATCTTCGTGCGGCACCTCGC
CGGAGCCCTCAAACCACTCCCCAATGGGCTTTAAGCCTCTCGAGACGTTGACGACCATCGGCGAGGAGCAGCCAG
GCGTCGTGACGGCCAGCCACGTCTCAACAGGCCACTTTAATTCCGTCGACGCCCAGACAGCCAACTTTGACTGGC
TGGCCAGCCAGAACGGGGGACAGTTCGACCCGCAGCTGTTCGGTGACTACCGCGAGCCCCAGGAAAACGTCTTGT
CCGGCGCCAACCTCGATGAGTTCTTCAACGACGCCCTCGACGCAGATTTCCTCACGCCCTACAACGTGCCCATGA
CGGCGCCGACGACGGGCCCCAGGCGAAACCTCATCGACGAAATTGACGCTGAGCAGAACGCGCTGGACGATGACG
TACCCAAGGAGTCAAACGTCCGATGCCACAAGATCTGGTAAAAATCCCTTCCCCTTCCTCTCACACGCGATGCAA
AGCCCTTGAGTCATACCTGTCGCTGACCATCCCATCTCCTCCGAAACAGGGACAAGCTACAGGGATGCCCCAAGG
CACAGAGCGGCGAGTTCGATCTCGACGGCCTCTGCTCGGAGCTCACGCAAAAGGCAAAGTGCTCCGGCCACGGGC
CCGTCGTCGCAGAGCGAGACTTTGACTCCATCCTTCGCAAGTACATGGGCAAGGACGTGTCGCCTCAGTGTGTCG
CCACGACTCTTGGCATCGAGGTCCATCCCGATGGGAAGCCCAATGGCGTGGCCATGCCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail