Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01245
Gene name
Locationscaffold_01:4480261..4481936
Strand-
Gene length (bp)1675
Transcript length (bp)1272
Coding sequence length (bp)1272
Protein length (aa) 424

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12311 DUF3632 Protein of unknown function (DUF3632) 1.3E-35 213 393

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1496 0.189 0.1005 0.0725 0.9377 0.0137 0.0516 0.0319 0.0612 0.0146

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup618
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|731
Ophiocordyceps australis 1348a (Ghana) OphauG2|732
Ophiocordyceps australis map64 (Brazil) OphauB2|450
Ophiocordyceps australis map64 (Brazil) OphauB2|451
Ophiocordyceps camponoti-floridani Ophcf2|01245 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3246
Ophiocordyceps kimflemingae Ophio5|2206
Ophiocordyceps kimflemingae Ophio5|2207

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01245
MHILRRTTGRLPVLTRAALHTTAPTRLAYKDSQDRNELRPRSNEHTLSGRDDDASSADADAAFDGSQTRPETEKR
RAERDGAVAAGPADQGLSKPRGDERDGRDRGPGVETEKGGASGGAHDVMQPHRDNPPILPPSSASILSLHPQPPS
SASNRPPACALDAHPHEAAIINLLTATVNDANPTARTAADAVDKLYPEGQDVGVVEDFLWSLWSLLVGTVKKIPA
HDARQKLLVDLVARLRDSRDDEVELWGQKTRVWTELPMLGPCMRDAWNLRPKLDGSDKDNAAILEWTSLNSFAAR
MFGADIQPWVNLAIWELRAALEEPPPSTTTARDAAIATVCEWIAHARHQLHRQGRQPRPLDAMEERALQPGKLFE
GGQSGLSDARWRFWRERLAELGPDAGSAELRDRAKAAVAQMRELEASA*
Coding >Ophcf2|01245
ATGCACATCCTCCGCCGCACTACCGGACGCCTCCCCGTCCTCACCCGGGCCGCTCTACACACCACGGCCCCCACG
CGGCTGGCCTACAAGGACTCTCAGGACCGGAACGAGCTGCGGCCACGGTCCAACGAGCACACGCTCTCGGGCCGC
GACGACGACGCCTCCTCCGCCGACGCGGACGCCGCTTTCGACGGTAGCCAGACGAGGCCCGAGACCGAGAAACGT
CGCGCCGAAAGGGATGGGGCCGTGGCGGCCGGGCCGGCGGATCAGGGGCTCAGCAAGCCGCGCGGGGACGAGAGG
GATGGGCGGGATCGCGGGCCCGGGGTGGAGACGGAGAAGGGAGGGGCCAGTGGCGGGGCCCACGACGTCATGCAA
CCCCATCGTGACAATCCACCAATTCTCCCTCCATCCTCAGCCTCCATCCTCAGCCTCCATCCTCAGCCTCCATCC
TCAGCCTCCAACCGCCCGCCCGCCTGCGCCCTCGACGCCCACCCCCACGAAGCCGCCATCATCAACCTCCTCACC
GCGACGGTCAACGACGCGAACCCCACGGCTCGCACCGCCGCAGACGCCGTCGACAAGCTGTACCCGGAGGGTCAG
GACGTTGGCGTTGTGGAAGATTTTCTCTGGTCCTTGTGGTCGCTGCTTGTTGGCACCGTCAAGAAGATTCCCGCC
CATGACGCTAGGCAGAAGCTCCTCGTCGACCTTGTGGCTCGCCTCCGCGATAGTCGCGATGATGAGGTCGAGCTC
TGGGGGCAGAAGACGAGGGTTTGGACCGAACTGCCCATGCTGGGACCCTGCATGAGGGACGCGTGGAACCTACGC
CCCAAACTCGACGGCTCCGACAAAGACAACGCCGCAATCCTCGAATGGACCTCGCTCAACTCCTTCGCCGCCCGC
ATGTTCGGCGCCGACATCCAGCCCTGGGTCAACCTAGCCATCTGGGAGCTCCGCGCCGCCCTCGAAGAACCCCCC
CCCTCGACGACGACGGCCCGAGACGCCGCCATCGCCACTGTCTGCGAGTGGATCGCCCACGCCCGCCACCAGCTG
CACCGCCAGGGCCGCCAGCCGCGTCCCCTCGACGCCATGGAGGAGAGGGCCCTCCAGCCCGGCAAGCTTTTCGAG
GGCGGGCAGTCGGGACTCAGCGACGCCAGGTGGCGCTTCTGGCGAGAGAGGCTGGCTGAATTGGGGCCCGATGCA
GGGAGCGCCGAGCTGAGGGACCGGGCCAAGGCGGCCGTGGCCCAGATGAGGGAGCTCGAGGCTTCGGCGTAG
Transcript >Ophcf2|01245
ATGCACATCCTCCGCCGCACTACCGGACGCCTCCCCGTCCTCACCCGGGCCGCTCTACACACCACGGCCCCCACG
CGGCTGGCCTACAAGGACTCTCAGGACCGGAACGAGCTGCGGCCACGGTCCAACGAGCACACGCTCTCGGGCCGC
GACGACGACGCCTCCTCCGCCGACGCGGACGCCGCTTTCGACGGTAGCCAGACGAGGCCCGAGACCGAGAAACGT
CGCGCCGAAAGGGATGGGGCCGTGGCGGCCGGGCCGGCGGATCAGGGGCTCAGCAAGCCGCGCGGGGACGAGAGG
GATGGGCGGGATCGCGGGCCCGGGGTGGAGACGGAGAAGGGAGGGGCCAGTGGCGGGGCCCACGACGTCATGCAA
CCCCATCGTGACAATCCACCAATTCTCCCTCCATCCTCAGCCTCCATCCTCAGCCTCCATCCTCAGCCTCCATCC
TCAGCCTCCAACCGCCCGCCCGCCTGCGCCCTCGACGCCCACCCCCACGAAGCCGCCATCATCAACCTCCTCACC
GCGACGGTCAACGACGCGAACCCCACGGCTCGCACCGCCGCAGACGCCGTCGACAAGCTGTACCCGGAGGGTCAG
GACGTTGGCGTTGTGGAAGATTTTCTCTGGTCCTTGTGGTCGCTGCTTGTTGGCACCGTCAAGAAGATTCCCGCC
CATGACGCTAGGCAGAAGCTCCTCGTCGACCTTGTGGCTCGCCTCCGCGATAGTCGCGATGATGAGGTCGAGCTC
TGGGGGCAGAAGACGAGGGTTTGGACCGAACTGCCCATGCTGGGACCCTGCATGAGGGACGCGTGGAACCTACGC
CCCAAACTCGACGGCTCCGACAAAGACAACGCCGCAATCCTCGAATGGACCTCGCTCAACTCCTTCGCCGCCCGC
ATGTTCGGCGCCGACATCCAGCCCTGGGTCAACCTAGCCATCTGGGAGCTCCGCGCCGCCCTCGAAGAACCCCCC
CCCTCGACGACGACGGCCCGAGACGCCGCCATCGCCACTGTCTGCGAGTGGATCGCCCACGCCCGCCACCAGCTG
CACCGCCAGGGCCGCCAGCCGCGTCCCCTCGACGCCATGGAGGAGAGGGCCCTCCAGCCCGGCAAGCTTTTCGAG
GGCGGGCAGTCGGGACTCAGCGACGCCAGGTGGCGCTTCTGGCGAGAGAGGCTGGCTGAATTGGGGCCCGATGCA
GGGAGCGCCGAGCTGAGGGACCGGGCCAAGGCGGCCGTGGCCCAGATGAGGGAGCTCGAGGCTTCGGCGTAG
Gene >Ophcf2|01245
ATGCACATCCTCCGCCGCACTACCGGACGCCTCCCCGTCCTCACCCGGGCCGCTCTACACACCACGGCCCCCACG
CGGCTGGCCTACAAGGACTCTCAGGACCGGAACGAGCTGCGGCCACGGTCCAACGAGCACACGCTCTCGGGCCGC
GACGACGACGCCTCCTCCGCCGACGCGGACGCCGCTTTCGACGGTAGCCAGACGAGGCCCGAGACCGAGAAACGT
CGCGCCGAAAGGGATGGGGCCGTGGCGGCCGGGCCGGCGGATCAGGGGCTCAGCAAGCCGCGCGGGGACGAGAGG
GATGGGCGGGATCGCGGGCCCGGGGTGGAGACGGAGAAGGGAGGGGCCAGTGGCGGGGGTCGGCGCCGAAGAAGG
GGAGGCCGTAGCCGGGCTCAATTTACATGAGCATGGTACCTACGAACATACCTACGAATAGATGTATTCGTATGT
ACGAAGGTACGAACACATCCATTCATTACTATTACTACCTACCTATGTATGTACCTACGAATACCCGTTCTTCCG
TCGTCCGTCGCCATCTCGCTTAAACGCAGCCTCATTGGTGGCTGCAACACCCCGCACCCACCAGCCCACGACGTC
ATGCAACCCCATCGTGACAATCCACCAATTCTCCCTCCATCCTCAGCCTCCATCCTCAGCCTCCATCCTCAGCCT
CCATCCTCAGCCTCCAACCGCCCGCCCGCCTGCGCCCTCGACGCCCACCCCGTACATACAGTCAGCCATGGCCCC
CCCCCAGCCGTCGACCTCTCAGACCTCCCATCCTCGACTTCACCCTCCTCCGCGAACCCCTCCCAGCACGAAGCC
GCCATCATCAACCTCCTCACCGCGACGGTCAACGACGCGAACCCCACGGCTCGCACCGCCGCAGACGCCGTCGAC
AAGCTGTACCCGGAGGGTCAGGACGTTGGCGTTGTGGAAGATTTTCTCTGGTCCTTGTGGTCGCTGCTTGTTGGC
ACCGTCAAGAAGATTCCCGCCCATGACGCTAGGCAGAAGCTCCTCGTCGACCTTGTGGCTCGCCTCCGCGATAGT
CGCGATGATGAGGTCGAGCTCTGGGGGCAGAAGACGAGGGTTTGGACCGAACTGCCCATGCTGGGACCCTGCATG
AGGGACGCGTGGAACCGTACGTCTCTGTTCCGTCATCTTTGCTTCTTCTTCTTCTTTTTCCTTTCCTCCCCCTCT
CCTAACAAGGGTACGAATACAAGTACGCCCCAAACTCGACGGCTCCGACAAAGACAACGCCGCAATCCTCGAATG
GACCTCGCTCAACTCCTTCGCCGCCCGCATGTTCGGCGCCGACATCCAGCCCTGGGTCAACCTAGCCATCTGGGA
GCTCCGCGCCGCCCTCGAAGAACCCCCCCCCTCGACGACGACGGCCCGAGACGCCGCCATCGCCACTGTCTGCGA
GTGGATCGCCCACGCCCGCCACCAGCTGCACCGCCAGGGCCGCCAGCCGCGTCCCCTCGACGCCATGGAGGAGAG
GGCCCTCCAGCCCGGCAAGCTTTTCGAGGGCGGGCAGTCGGGACTCAGCGACGCCAGGTGGCGCTTCTGGCGAGA
GAGGCTGGCTGAATTGGGGCCCGATGCAGGGAGCGCCGAGCTGAGGGACCGGGCCAAGGCGGCCGTGGCCCAGAT
GAGGGAGCTCGAGGCTTCGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail