Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01240
Gene name
Locationscaffold_01:4468825..4470945
Strand+
Gene length (bp)2120
Transcript length (bp)2037
Coding sequence length (bp)2037
Protein length (aa) 679

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 1.4E-08 315 509

GO

GO Term Description Terminal node
GO:0071704 organic substance metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 159 181 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01240
MPRREPPARPAQGARRRQGQAAETSKKTRTKKKSPPTRSDESSGDRALSAAALAQLDRENARQSRKIPARKRPQR
PLHHQPEVVPPPPPPPPPPPPAPKHRHDGHQHRVGKKQKTRRVVSGAAMEEGRGRRLRGDSSEDSFEKPDVHRRP
RKKKSRKKLWILLACSVAIVIIIIIVAVVVSKNKAGGDGASSLDGKDRGSIPDKWRGTYLDPWSWQTTSDFNVTF
TQDMVGGLPVMGLFTDWDDSSRANDQVPPLKESWGPYGKRPARGVNLGGWLSLEPFITPSLFRYDGVVDEWSLCR
RLGPASAAKTLEDHYANFVTEDTFRAIAAAGLDHVRIPFSYWAVEVYDGDPYVFRISWRYLLRGIEWARRHGLRV
NLDLHALPGSQNGWNHSGRSGAIGWLNGTDGALNGRRSMEIHDRLSRFFAQPRYRNIVTHYGLVNEPKMTFLAVD
DVVAWTRRAHDTVRANGVTALVVFGDGFMGLEKWKGLMPRDMVLDVHQYLIFNENQIDFSHRRKVQYACSGWSQQ
ADLSMDPARGHGPTVFAEWSQADTDCARFLTGVGWGNRWEGTYDSGDAATSVLEPRCPAGNRSCSCASANEPDAS
RMSPAYRRFLQLFAEAQMHSFERGWGWWYWTWKTEAAPLWSYEAGLRAGILPRLAYHRDFNCDADVPDFAADGLP
ETY*
Coding >Ophcf2|01240
ATGCCACGGAGAGAACCACCGGCCCGCCCCGCGCAAGGAGCCCGCCGTCGCCAAGGTCAAGCGGCGGAGACTTCG
AAGAAGACTCGGACCAAGAAGAAGAGTCCGCCGACGAGGTCCGACGAGAGCAGCGGAGATAGGGCACTCTCCGCC
GCCGCTCTCGCTCAGCTCGACCGGGAGAACGCACGACAGAGTCGCAAGATTCCCGCGCGGAAACGGCCGCAGCGG
CCTTTGCATCATCAGCCCGAGGTTGTGCCTCCTCCTCCTCCTCCTCCTCCTCCTCCGCCCCCGGCTCCCAAGCAC
CGCCATGACGGCCATCAGCATAGAGTCGGGAAGAAGCAGAAGACGAGGAGGGTTGTTAGCGGGGCGGCCATGGAG
GAAGGGCGCGGGAGGCGTCTGCGAGGTGACAGTAGCGAGGACAGCTTCGAGAAGCCGGACGTTCATCGGCGACCG
CGCAAGAAGAAATCGAGGAAGAAGCTGTGGATCTTGCTGGCCTGCAGCGTCGCCATCGTCATCATCATCATCATC
GTGGCCGTCGTCGTCAGCAAGAACAAAGCAGGCGGCGATGGAGCGTCCAGCCTCGACGGCAAAGACCGGGGCTCG
ATCCCCGATAAATGGCGCGGGACATATCTCGACCCGTGGTCCTGGCAGACGACATCCGACTTCAACGTGACGTTT
ACCCAAGATATGGTAGGCGGCCTGCCCGTCATGGGCCTCTTCACAGACTGGGACGACTCGTCCCGGGCCAACGAC
CAGGTGCCGCCGCTCAAGGAGTCATGGGGCCCGTACGGAAAGCGGCCGGCGCGGGGCGTCAATCTCGGGGGCTGG
CTCTCGCTCGAGCCCTTTATCACGCCTTCGCTGTTCCGGTATGACGGAGTGGTGGACGAATGGAGTCTCTGTCGT
CGGCTCGGGCCGGCTTCGGCGGCAAAGACGCTCGAGGATCATTATGCCAACTTCGTGACAGAGGATACGTTCCGG
GCCATAGCGGCGGCGGGACTGGATCACGTCCGGATCCCCTTTTCGTACTGGGCCGTCGAGGTCTATGACGGGGAC
CCGTACGTCTTCCGCATCTCATGGAGATATCTTCTTCGCGGCATCGAGTGGGCGAGACGCCATGGCCTCCGCGTC
AACCTTGATCTTCACGCGCTGCCTGGTAGCCAGAATGGCTGGAACCACAGCGGTCGATCCGGGGCCATCGGCTGG
CTCAACGGCACCGACGGCGCTCTCAACGGCCGGCGCTCGATGGAGATACACGATCGGCTATCACGATTCTTCGCT
CAGCCGCGTTATCGTAACATCGTGACGCACTATGGGCTCGTCAACGAACCAAAGATGACTTTCTTGGCCGTCGAT
GATGTCGTCGCCTGGACGAGACGCGCTCACGATACGGTCCGCGCCAACGGAGTCACCGCCCTCGTCGTCTTTGGC
GATGGCTTCATGGGCCTCGAGAAGTGGAAGGGTCTCATGCCGCGAGACATGGTGCTCGACGTCCATCAGTACCTC
ATCTTCAACGAGAACCAGATCGACTTTTCCCACCGTCGCAAGGTCCAGTACGCCTGCAGCGGATGGTCCCAGCAG
GCCGACCTCAGTATGGATCCGGCCCGGGGTCACGGCCCTACCGTCTTCGCCGAATGGTCTCAGGCCGACACCGAC
TGCGCCCGCTTCCTCACCGGCGTCGGCTGGGGTAACCGCTGGGAGGGCACCTATGACTCGGGCGATGCCGCCACC
TCGGTTCTCGAGCCTCGCTGTCCGGCCGGGAACCGGTCCTGCTCGTGCGCGTCTGCCAACGAGCCCGACGCGTCC
CGCATGAGTCCGGCCTACCGCCGCTTTCTGCAGCTCTTCGCCGAGGCCCAGATGCATAGCTTCGAGCGCGGATGG
GGCTGGTGGTACTGGACCTGGAAGACCGAGGCCGCACCGTTGTGGAGCTACGAAGCCGGTCTCCGCGCCGGCATC
TTGCCCCGGCTGGCCTATCATCGCGATTTCAACTGTGACGCCGACGTTCCGGACTTTGCTGCAGATGGCTTGCCG
GAGACGTACTGA
Transcript >Ophcf2|01240
ATGCCACGGAGAGAACCACCGGCCCGCCCCGCGCAAGGAGCCCGCCGTCGCCAAGGTCAAGCGGCGGAGACTTCG
AAGAAGACTCGGACCAAGAAGAAGAGTCCGCCGACGAGGTCCGACGAGAGCAGCGGAGATAGGGCACTCTCCGCC
GCCGCTCTCGCTCAGCTCGACCGGGAGAACGCACGACAGAGTCGCAAGATTCCCGCGCGGAAACGGCCGCAGCGG
CCTTTGCATCATCAGCCCGAGGTTGTGCCTCCTCCTCCTCCTCCTCCTCCTCCTCCGCCCCCGGCTCCCAAGCAC
CGCCATGACGGCCATCAGCATAGAGTCGGGAAGAAGCAGAAGACGAGGAGGGTTGTTAGCGGGGCGGCCATGGAG
GAAGGGCGCGGGAGGCGTCTGCGAGGTGACAGTAGCGAGGACAGCTTCGAGAAGCCGGACGTTCATCGGCGACCG
CGCAAGAAGAAATCGAGGAAGAAGCTGTGGATCTTGCTGGCCTGCAGCGTCGCCATCGTCATCATCATCATCATC
GTGGCCGTCGTCGTCAGCAAGAACAAAGCAGGCGGCGATGGAGCGTCCAGCCTCGACGGCAAAGACCGGGGCTCG
ATCCCCGATAAATGGCGCGGGACATATCTCGACCCGTGGTCCTGGCAGACGACATCCGACTTCAACGTGACGTTT
ACCCAAGATATGGTAGGCGGCCTGCCCGTCATGGGCCTCTTCACAGACTGGGACGACTCGTCCCGGGCCAACGAC
CAGGTGCCGCCGCTCAAGGAGTCATGGGGCCCGTACGGAAAGCGGCCGGCGCGGGGCGTCAATCTCGGGGGCTGG
CTCTCGCTCGAGCCCTTTATCACGCCTTCGCTGTTCCGGTATGACGGAGTGGTGGACGAATGGAGTCTCTGTCGT
CGGCTCGGGCCGGCTTCGGCGGCAAAGACGCTCGAGGATCATTATGCCAACTTCGTGACAGAGGATACGTTCCGG
GCCATAGCGGCGGCGGGACTGGATCACGTCCGGATCCCCTTTTCGTACTGGGCCGTCGAGGTCTATGACGGGGAC
CCGTACGTCTTCCGCATCTCATGGAGATATCTTCTTCGCGGCATCGAGTGGGCGAGACGCCATGGCCTCCGCGTC
AACCTTGATCTTCACGCGCTGCCTGGTAGCCAGAATGGCTGGAACCACAGCGGTCGATCCGGGGCCATCGGCTGG
CTCAACGGCACCGACGGCGCTCTCAACGGCCGGCGCTCGATGGAGATACACGATCGGCTATCACGATTCTTCGCT
CAGCCGCGTTATCGTAACATCGTGACGCACTATGGGCTCGTCAACGAACCAAAGATGACTTTCTTGGCCGTCGAT
GATGTCGTCGCCTGGACGAGACGCGCTCACGATACGGTCCGCGCCAACGGAGTCACCGCCCTCGTCGTCTTTGGC
GATGGCTTCATGGGCCTCGAGAAGTGGAAGGGTCTCATGCCGCGAGACATGGTGCTCGACGTCCATCAGTACCTC
ATCTTCAACGAGAACCAGATCGACTTTTCCCACCGTCGCAAGGTCCAGTACGCCTGCAGCGGATGGTCCCAGCAG
GCCGACCTCAGTATGGATCCGGCCCGGGGTCACGGCCCTACCGTCTTCGCCGAATGGTCTCAGGCCGACACCGAC
TGCGCCCGCTTCCTCACCGGCGTCGGCTGGGGTAACCGCTGGGAGGGCACCTATGACTCGGGCGATGCCGCCACC
TCGGTTCTCGAGCCTCGCTGTCCGGCCGGGAACCGGTCCTGCTCGTGCGCGTCTGCCAACGAGCCCGACGCGTCC
CGCATGAGTCCGGCCTACCGCCGCTTTCTGCAGCTCTTCGCCGAGGCCCAGATGCATAGCTTCGAGCGCGGATGG
GGCTGGTGGTACTGGACCTGGAAGACCGAGGCCGCACCGTTGTGGAGCTACGAAGCCGGTCTCCGCGCCGGCATC
TTGCCCCGGCTGGCCTATCATCGCGATTTCAACTGTGACGCCGACGTTCCGGACTTTGCTGCAGATGGCTTGCCG
GAGACGTACTGA
Gene >Ophcf2|01240
ATGCCACGGAGAGAACCACCGGCCCGCCCCGCGCAAGGAGCCCGCCGTCGCCAAGGTCAAGCGGCGGAGACTTCG
AAGAAGACTCGGACCAAGAAGAAGAGTCCGCCGACGAGGTCCGACGAGAGCAGCGGAGATAGGGCACTCTCCGCC
GCCGCTCTCGCTCAGCTCGACCGGGAGAACGCACGACAGAGTCGCAAGATTCCCGCGCGGAAACGGCCGCAGCGG
CCTTTGCATCATCAGCCCGAGGTTGTGCCTCCTCCTCCTCCTCCTCCTCCTCCTCCGCCCCCGGCTCCCAAGCAC
CGCCATGACGGCCATCAGCATAGAGTCGGGAAGAAGCAGAAGACGAGGAGGGTTGTTAGCGGGGCGGCCATGGAG
GAAGGGCGCGGGAGGCGTCTGCGAGGTGACAGTAGCGAGGACAGCTTCGAGAAGCCGGACGTTCATCGGCGACCG
CGCAAGAAGAAATCGAGGAAGAAGCTGTGTAAGTGATGACTACTGGGAACAATACGTTGATCTCGAGTTTGTTCC
CTCTGGGGCTAACCATCATCTCCGGCTTCGAATCAGGGATCTTGCTGGCCTGCAGCGTCGCCATCGTCATCATCA
TCATCATCGTGGCCGTCGTCGTCAGCAAGAACAAAGCAGGCGGCGATGGAGCGTCCAGCCTCGACGGCAAAGACC
GGGGCTCGATCCCCGATAAATGGCGCGGGACATATCTCGACCCGTGGTCCTGGCAGACGACATCCGACTTCAACG
TGACGTTTACCCAAGATATGGTAGGCGGCCTGCCCGTCATGGGCCTCTTCACAGACTGGGACGACTCGTCCCGGG
CCAACGACCAGGTGCCGCCGCTCAAGGAGTCATGGGGCCCGTACGGAAAGCGGCCGGCGCGGGGCGTCAATCTCG
GGGGCTGGCTCTCGCTCGAGCCCTTTATCACGCCTTCGCTGTTCCGGTATGACGGAGTGGTGGACGAATGGAGTC
TCTGTCGTCGGCTCGGGCCGGCTTCGGCGGCAAAGACGCTCGAGGATCATTATGCCAACTTCGTGACAGAGGATA
CGTTCCGGGCCATAGCGGCGGCGGGACTGGATCACGTCCGGATCCCCTTTTCGTACTGGGCCGTCGAGGTCTATG
ACGGGGACCCGTACGTCTTCCGCATCTCATGGAGATATCTTCTTCGCGGCATCGAGTGGGCGAGACGCCATGGCC
TCCGCGTCAACCTTGATCTTCACGCGCTGCCTGGTAGCCAGAATGGCTGGAACCACAGCGGTCGATCCGGGGCCA
TCGGCTGGCTCAACGGCACCGACGGCGCTCTCAACGGCCGGCGCTCGATGGAGATACACGATCGGCTATCACGAT
TCTTCGCTCAGCCGCGTTATCGTAACATCGTGACGCACTATGGGCTCGTCAACGAACCAAAGATGACTTTCTTGG
CCGTCGATGATGTCGTCGCCTGGACGAGACGCGCTCACGATACGGTCCGCGCCAACGGAGTCACCGCCCTCGTCG
TCTTTGGCGATGGCTTCATGGGCCTCGAGAAGTGGAAGGGTCTCATGCCGCGAGACATGGTGCTCGACGTCCATC
AGTACCTCATCTTCAACGAGAACCAGATCGACTTTTCCCACCGTCGCAAGGTCCAGTACGCCTGCAGCGGATGGT
CCCAGCAGGCCGACCTCAGTATGGATCCGGCCCGGGGTCACGGCCCTACCGTCTTCGCCGAATGGTCTCAGGCCG
ACACCGACTGCGCCCGCTTCCTCACCGGCGTCGGCTGGGGTAACCGCTGGGAGGGCACCTATGACTCGGGCGATG
CCGCCACCTCGGTTCTCGAGCCTCGCTGTCCGGCCGGGAACCGGTCCTGCTCGTGCGCGTCTGCCAACGAGCCCG
ACGCGTCCCGCATGAGTCCGGCCTACCGCCGCTTTCTGCAGCTCTTCGCCGAGGCCCAGATGCATAGCTTCGAGC
GCGGATGGGGCTGGTGGTACTGGACCTGGAAGACCGAGGCCGCACCGTTGTGGAGCTACGAAGCCGGTCTCCGCG
CCGGCATCTTGCCCCGGCTGGCCTATCATCGCGATTTCAACTGTGACGCCGACGTTCCGGACTTTGCTGCAGATG
GCTTGCCGGAGACGTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail