Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01233
Gene name
Locationscaffold_01:4450378..4451989
Strand+
Gene length (bp)1611
Transcript length (bp)1437
Coding sequence length (bp)1437
Protein length (aa) 479

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08595 RXT2_N RXT2-like, N-terminal 8.1E-47 36 177

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3487 0.9277 0.0548 0.0637 0.0747 0.0067 0.0332 0.0214 0.0112 0.0297

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6295
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3946
Ophiocordyceps australis map64 (Brazil) OphauB2|489
Ophiocordyceps camponoti-floridani Ophcf2|01233 (this protein)
Ophiocordyceps kimflemingae Ophio5|3869
Ophiocordyceps subramaniannii Hirsu2|8772

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01233
MTSQQILFAETIAGMKKAFKRKAYESDSDSEVEGYSNRGNKLKKRARFARQGQLAPTQGPSAYKETVEFAGTLRA
IIHRNPPLLDEDGYEIDSDDDDERVEEATLSSANLNPYANVRLEQILAPLTASTDLPTHPTLSKPFVSKTLTDLV
SQSCELMRRENKSLWRIRHLWTALCGDGTWMPCGLMVEPDDVTLYTEDHVARHLENLARADVKEQNGDTSRHGHS
DGGNDGGDAESVRRSGGVFMSNSGSGRSKQEAMTISKETNGQQTPCEGREKAKNGDAEDDEVRNKVAKRPRREGY
GTDDGAISRQDMLLLGEVHEPMDKTMKDVDPSADATTPPRTGGDTITSRASEGPSEQQSFIHPIFAMPAGARPDR
NLGLPEPEAEDIRRLLSLFIQKQEEICRGATRLHHGLLRAERLRNDVLHWSKAEAHCGPNRDLSDGEDWYDVAEW
GLTEDLKKGQDEEEEDTATAGKKTRNRR*
Coding >Ophcf2|01233
ATGACGTCGCAGCAGATTCTCTTCGCCGAGACGATAGCCGGCATGAAAAAGGCTTTCAAGAGAAAGGCTTACGAG
TCCGACTCCGATTCCGAGGTGGAAGGCTACAGCAACCGCGGCAACAAGCTTAAGAAGCGGGCTCGTTTCGCGCGT
CAGGGGCAGCTGGCGCCCACGCAGGGGCCAAGCGCCTACAAGGAGACGGTCGAGTTCGCAGGCACCCTGAGAGCC
ATCATCCATCGCAACCCGCCCCTTCTCGACGAGGATGGCTACGAGATTGATAGCGACGACGACGACGAGCGCGTC
GAGGAGGCGACTCTCTCTTCCGCCAATCTGAACCCGTACGCCAATGTGCGGCTGGAACAGATACTGGCGCCCTTG
ACAGCCTCGACCGATCTGCCCACTCACCCGACCCTATCGAAGCCATTTGTCTCCAAGACTCTGACAGACCTAGTC
TCGCAGAGCTGTGAGCTGATGCGAAGGGAGAACAAGTCCCTGTGGCGTATCAGACACCTTTGGACCGCCCTCTGC
GGCGATGGCACTTGGATGCCGTGCGGCCTCATGGTCGAACCCGATGACGTGACCCTTTACACGGAAGATCACGTC
GCCCGGCACCTGGAAAACCTGGCCCGAGCAGACGTCAAGGAGCAGAATGGCGACACGTCGAGACATGGCCACTCT
GATGGTGGAAACGACGGTGGAGACGCAGAGAGTGTACGCCGCAGCGGCGGGGTCTTCATGTCAAATTCAGGGTCC
GGCCGGTCGAAGCAGGAGGCGATGACGATTTCGAAAGAGACAAATGGACAACAAACGCCATGTGAGGGCCGCGAG
AAGGCCAAGAATGGAGACGCGGAAGACGATGAGGTCAGGAACAAGGTTGCAAAGAGGCCGAGACGCGAGGGATAC
GGCACAGACGACGGCGCCATATCGAGGCAGGACATGCTGCTCCTTGGGGAAGTTCACGAACCGATGGACAAGACG
ATGAAGGACGTTGATCCTTCAGCAGACGCCACAACTCCCCCGCGGACTGGCGGCGACACGATTACGTCGAGGGCG
TCCGAGGGACCTTCCGAGCAGCAGTCCTTTATCCATCCCATCTTCGCGATGCCGGCAGGCGCCAGGCCAGACCGA
AACCTCGGCCTCCCTGAGCCCGAAGCCGAAGACATCCGACGGCTGCTATCTCTCTTCATCCAGAAGCAGGAGGAG
ATCTGCCGCGGAGCTACTCGTCTGCACCACGGCCTCCTGCGGGCGGAACGACTCCGAAACGACGTGCTGCACTGG
TCCAAGGCCGAGGCGCACTGCGGACCCAACCGGGACCTTTCCGACGGCGAGGATTGGTATGACGTTGCAGAATGG
GGTCTTACCGAGGACCTGAAGAAGGGTCAGGATGAAGAGGAGGAGGATACGGCCACGGCGGGCAAGAAGACGAGG
AACCGCCGGTAA
Transcript >Ophcf2|01233
ATGACGTCGCAGCAGATTCTCTTCGCCGAGACGATAGCCGGCATGAAAAAGGCTTTCAAGAGAAAGGCTTACGAG
TCCGACTCCGATTCCGAGGTGGAAGGCTACAGCAACCGCGGCAACAAGCTTAAGAAGCGGGCTCGTTTCGCGCGT
CAGGGGCAGCTGGCGCCCACGCAGGGGCCAAGCGCCTACAAGGAGACGGTCGAGTTCGCAGGCACCCTGAGAGCC
ATCATCCATCGCAACCCGCCCCTTCTCGACGAGGATGGCTACGAGATTGATAGCGACGACGACGACGAGCGCGTC
GAGGAGGCGACTCTCTCTTCCGCCAATCTGAACCCGTACGCCAATGTGCGGCTGGAACAGATACTGGCGCCCTTG
ACAGCCTCGACCGATCTGCCCACTCACCCGACCCTATCGAAGCCATTTGTCTCCAAGACTCTGACAGACCTAGTC
TCGCAGAGCTGTGAGCTGATGCGAAGGGAGAACAAGTCCCTGTGGCGTATCAGACACCTTTGGACCGCCCTCTGC
GGCGATGGCACTTGGATGCCGTGCGGCCTCATGGTCGAACCCGATGACGTGACCCTTTACACGGAAGATCACGTC
GCCCGGCACCTGGAAAACCTGGCCCGAGCAGACGTCAAGGAGCAGAATGGCGACACGTCGAGACATGGCCACTCT
GATGGTGGAAACGACGGTGGAGACGCAGAGAGTGTACGCCGCAGCGGCGGGGTCTTCATGTCAAATTCAGGGTCC
GGCCGGTCGAAGCAGGAGGCGATGACGATTTCGAAAGAGACAAATGGACAACAAACGCCATGTGAGGGCCGCGAG
AAGGCCAAGAATGGAGACGCGGAAGACGATGAGGTCAGGAACAAGGTTGCAAAGAGGCCGAGACGCGAGGGATAC
GGCACAGACGACGGCGCCATATCGAGGCAGGACATGCTGCTCCTTGGGGAAGTTCACGAACCGATGGACAAGACG
ATGAAGGACGTTGATCCTTCAGCAGACGCCACAACTCCCCCGCGGACTGGCGGCGACACGATTACGTCGAGGGCG
TCCGAGGGACCTTCCGAGCAGCAGTCCTTTATCCATCCCATCTTCGCGATGCCGGCAGGCGCCAGGCCAGACCGA
AACCTCGGCCTCCCTGAGCCCGAAGCCGAAGACATCCGACGGCTGCTATCTCTCTTCATCCAGAAGCAGGAGGAG
ATCTGCCGCGGAGCTACTCGTCTGCACCACGGCCTCCTGCGGGCGGAACGACTCCGAAACGACGTGCTGCACTGG
TCCAAGGCCGAGGCGCACTGCGGACCCAACCGGGACCTTTCCGACGGCGAGGATTGGTATGACGTTGCAGAATGG
GGTCTTACCGAGGACCTGAAGAAGGGTCAGGATGAAGAGGAGGAGGATACGGCCACGGCGGGCAAGAAGACGAGG
AACCGCCGGTAA
Gene >Ophcf2|01233
ATGACGTCGCAGCAGATTCTCTTCGCCGAGACGATAGCCGGCATGAAAAAGGCTTTCAAGAGAAAGGCTTACGGT
GAGGCTGGTTTCTCTCGATTGTAATCTTGCAGCGGCTGACCTTGTTTCTTGCCTCAACAGAGTCCGACTCCGATT
CCGAGGTGGAAGGCTACAGCAACCGCGGCAACAAGCTTAAGAAGCGGGCTCGTTTCGCGCGTCAGGGGCAGCTGG
CGCCCACGCAGGGGCCAAGCGCCTACAAGGAGGTCGGTCTCGGGCTCTCGTCTGCCGGTTCACCCCATTCGCTGA
CTTCCGCCCAGACGGTCGAGTTCGCAGGCACCCTGAGAGCCATCATCCATCGCAACCCGCCCCTTCTCGACGAGG
ATGGCTACGAGATTGATAGCGACGACGACGACGAGCGCGTCGAGGAGGCGACTCTCTCTTCCGCCAATCTGAACC
CGTACGCCAATGTGCGGCTGGAACGTGAGTCGCCCGTCGAGGGCTCCCGGGGAGAAGAGATTTCTGACGGATTGG
CCCGCAGAGATACTGGCGCCCTTGACAGCCTCGACCGATCTGCCCACTCACCCGACCCTATCGAAGCCATTTGTC
TCCAAGACTCTGACAGACCTAGTCTCGCAGAGCTGTGAGCTGATGCGAAGGGAGAACAAGTCCCTGTGGCGTATC
AGACACCTTTGGACCGCCCTCTGCGGCGATGGCACTTGGATGCCGTGCGGCCTCATGGTCGAACCCGATGACGTG
ACCCTTTACACGGAAGATCACGTCGCCCGGCACCTGGAAAACCTGGCCCGAGCAGACGTCAAGGAGCAGAATGGC
GACACGTCGAGACATGGCCACTCTGATGGTGGAAACGACGGTGGAGACGCAGAGAGTGTACGCCGCAGCGGCGGG
GTCTTCATGTCAAATTCAGGGTCCGGCCGGTCGAAGCAGGAGGCGATGACGATTTCGAAAGAGACAAATGGACAA
CAAACGCCATGTGAGGGCCGCGAGAAGGCCAAGAATGGAGACGCGGAAGACGATGAGGTCAGGAACAAGGTTGCA
AAGAGGCCGAGACGCGAGGGATACGGCACAGACGACGGCGCCATATCGAGGCAGGACATGCTGCTCCTTGGGGAA
GTTCACGAACCGATGGACAAGACGATGAAGGACGTTGATCCTTCAGCAGACGCCACAACTCCCCCGCGGACTGGC
GGCGACACGATTACGTCGAGGGCGTCCGAGGGACCTTCCGAGCAGCAGTCCTTTATCCATCCCATCTTCGCGATG
CCGGCAGGCGCCAGGCCAGACCGAAACCTCGGCCTCCCTGAGCCCGAAGCCGAAGACATCCGACGGCTGCTATCT
CTCTTCATCCAGAAGCAGGAGGAGATCTGCCGCGGAGCTACTCGTCTGCACCACGGCCTCCTGCGGGCGGAACGA
CTCCGAAACGACGTGCTGCACTGGTCCAAGGCCGAGGCGCACTGCGGACCCAACCGGGACCTTTCCGACGGCGAG
GATTGGTATGACGTTGCAGAATGGGGTCTTACCGAGGACCTGAAGAAGGGTCAGGATGAAGAGGAGGAGGATACG
GCCACGGCGGGCAAGAAGACGAGGAACCGCCGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail