Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01225
Gene name
Locationscaffold_01:4430515..4431162
Strand+
Gene length (bp)647
Transcript length (bp)582
Coding sequence length (bp)582
Protein length (aa) 194

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05871 ESCRT-II ESCRT-II complex subunit 6.5E-52 15 162

GO

GO Term Description Terminal node
GO:0071985 multivesicular body sorting pathway Yes
GO:0000814 ESCRT II complex Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0036452 ESCRT complex No
GO:0016192 vesicle-mediated transport No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0006810 transport No
GO:0098796 membrane protein complex No
GO:0051234 establishment of localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus|Lysosome/Vacuole Nuclear localization signal|Nuclear export signal 0.499 0.6095 0.0358 0.0937 0.1635 0.0443 0.0727 0.6713 0.4369 0.0089

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5582
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|143
Ophiocordyceps australis map64 (Brazil) OphauB2|496
Ophiocordyceps camponoti-floridani Ophcf2|01225 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1552
Ophiocordyceps subramaniannii Hirsu2|7463

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01225
MSTSPPVPPFPFPREYHFPAFFTRQTNLTTHHAQLVKWSALILSYARHHRLFRLHVSSAAESDLFFNRRIDRRLA
PADIRDVLDFMRRDGRADYLDPAAATAAAAAAGPSSDVVLVYWRALEEWADVVEAFVEASAQRGAVLTLYELTDG
EATRGTEIHGMDSQVLLKALNILVKRNKAQIFGHEDSLGIKFF*
Coding >Ophcf2|01225
ATGTCCACATCACCACCCGTGCCGCCCTTCCCCTTCCCCCGCGAATACCACTTCCCCGCCTTCTTCACCCGCCAA
ACCAACCTGACAACGCACCACGCCCAACTGGTCAAATGGTCGGCCCTAATCCTATCCTACGCGCGCCACCACCGC
CTCTTCCGCCTGCACGTCTCCTCCGCGGCGGAATCGGACCTCTTCTTCAACAGGCGGATCGATCGTCGTCTCGCC
CCGGCGGATATCCGCGACGTGCTGGATTTTATGCGCAGGGATGGGAGGGCTGATTATCTGGATCCCGCGGCTGCT
ACCGCTGCTGCCGCCGCCGCCGGCCCGTCGTCGGATGTCGTCCTTGTTTATTGGAGGGCGCTCGAGGAGTGGGCT
GATGTCGTCGAGGCCTTTGTTGAGGCTTCGGCGCAGAGGGGTGCTGTTTTGACGCTCTATGAGCTTACTGATGGT
GAGGCTACCAGGGGAACTGAGATACACGGCATGGACAGCCAAGTCCTTCTCAAAGCTCTCAACATCCTCGTCAAA
CGCAACAAGGCCCAAATCTTTGGCCACGAAGACTCGCTCGGCATCAAATTCTTCTGA
Transcript >Ophcf2|01225
ATGTCCACATCACCACCCGTGCCGCCCTTCCCCTTCCCCCGCGAATACCACTTCCCCGCCTTCTTCACCCGCCAA
ACCAACCTGACAACGCACCACGCCCAACTGGTCAAATGGTCGGCCCTAATCCTATCCTACGCGCGCCACCACCGC
CTCTTCCGCCTGCACGTCTCCTCCGCGGCGGAATCGGACCTCTTCTTCAACAGGCGGATCGATCGTCGTCTCGCC
CCGGCGGATATCCGCGACGTGCTGGATTTTATGCGCAGGGATGGGAGGGCTGATTATCTGGATCCCGCGGCTGCT
ACCGCTGCTGCCGCCGCCGCCGGCCCGTCGTCGGATGTCGTCCTTGTTTATTGGAGGGCGCTCGAGGAGTGGGCT
GATGTCGTCGAGGCCTTTGTTGAGGCTTCGGCGCAGAGGGGTGCTGTTTTGACGCTCTATGAGCTTACTGATGGT
GAGGCTACCAGGGGAACTGAGATACACGGCATGGACAGCCAAGTCCTTCTCAAAGCTCTCAACATCCTCGTCAAA
CGCAACAAGGCCCAAATCTTTGGCCACGAAGACTCGCTCGGCATCAAATTCTTCTGA
Gene >Ophcf2|01225
ATGTCCACATCACCACCCGTGCCGCCCTTCCCCTTCCCCCGCGAATACCACTTCCCCGCCTTCTTCACCCGCCAA
ACCAACCTGACAACGCACCACGCCCAACTGGTCAAATGGTCGGCCCTAATCCTATCCTACGCGCGCCACCACCGC
CTCTTCCGCCTGCACGTCTCCTCCGCGGCGGAATCGGACCTCTTCTTCAACAGGCGGATCGATCGTCGTCTCGCC
CCGGCGGATATCCGCGACGTGCTGGATTTTATGCGCAGGGATGGGAGGGCTGATTATCTGGATCCCGCGGCTGCT
ACCGCTGCTGCCGCCGCCGCCGGCCCGTCGTCGGATGTCGTCCTTGTTTATTGGAGGGCGCTCGAGGAGTGGGCT
GATGTCGTCGAGGCCTTTGTTGAGGCTTCGGCGCAGAGGGGTGCTGTTTTGACGCTCTATGAGCTTACTGATGGT
GAGGCTACCAGGGGAACTGGTTCGTTGACGACTCTTCTCTCCTCGTCGGTTGTTCACGATTTTTTACTCATCAGT
GCAAAGCAGAGATACACGGCATGGACAGCCAAGTCCTTCTCAAAGCTCTCAACATCCTCGTCAAACGCAACAAGG
CCCAAATCTTTGGCCACGAAGACTCGCTCGGCATCAAATTCTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail