Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01211
Gene name
Locationscaffold_01:4382864..4384837
Strand-
Gene length (bp)1973
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05187 ETF_QO Electron transfer flavoprotein-ubiquinone oxidoreductase, 4Fe-4S 1.8E-48 533 636
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.1E-09 99 157
PF00890 FAD_binding_2 FAD binding domain 1.9E-04 96 138
PF12831 FAD_oxidored FAD dependent oxidoreductase 2.6E-06 96 243

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1096 0.0967 0.0369 0.1072 0.9414 0.0786 0.0805 0.0429 0.1105 0.0151

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1685
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1450
Ophiocordyceps australis map64 (Brazil) OphauB2|3376
Ophiocordyceps camponoti-floridani Ophcf2|01211 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5127
Ophiocordyceps kimflemingae Ophio5|5598
Ophiocordyceps subramaniannii Hirsu2|1459

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01211
MAAPSAVVARCASRAAIASRCCTRPSCRTPLQPALTTTATTTTTTTTTTTLTTTTLRSVLSAAAGSRPRRWFSAG
VPRRRPTDEHGTPERESDQVDVCIVGGGPAGLSAAIRLKQLAAERDDFRVLVLEKAGDVGGHILSGAVLQPTSLR
ELLPNWIDDDNPSRFQHATPAGADHMRFLTRSAAIPLPAPPQMSNHGNYIVSLNQFVKWLGEQAEEAGVEVYPGF
AAAEVLYGPDGSVKGVATNDVGIAKDGRRKDTFQPGMEFHARLTLFAEGCHGSLSKQVINKFDLRKDSQHQTYGL
GLKELWEVDPAKFESGRVVHAMGYPLPRDVYGGSFMYHFGDNLVSLGMVVSLDYRNPWMSPYQEFQKLKHHPLFS
RVIEGGKCISYGARSLVEGGFQSIPKVAFPGGALIGDSAGFVNVPKVKGTHNAIKSGMLAAEAAWTALSQSSDGT
VFLYDYEDSLRQSSVWKELREVRNMRPSFHTPLGVYGGLAYSGLEAFLLKGRSPWTLKHKEPDHAATQPADRYPK
IDYEKPDGKISFDILTSVSRTGTNHEEDQPVHLQVADWDAHTDKAYPAFKGLENRFCPAGVYEYVEDASKPHGVR
FQINAQNCIHCKTCDIKAPQQDINWQVPQGGEGPKYYMT*
Coding >Ophcf2|01211
ATGGCTGCCCCTTCAGCTGTCGTCGCCAGGTGCGCATCACGAGCCGCCATCGCCAGCCGATGCTGCACGCGCCCT
TCGTGCCGGACGCCGCTCCAGCCGGCGTTGACGACGACCGCGACGACCACGACGACCACGACGACCACGACGACC
TTGACCACGACCACGCTGCGATCCGTCCTCTCCGCCGCCGCTGGCAGCCGGCCCAGGCGATGGTTCAGCGCGGGC
GTCCCTCGGCGACGGCCAACGGACGAGCACGGAACCCCCGAACGCGAATCGGATCAGGTGGACGTGTGTATCGTC
GGCGGCGGACCTGCTGGCTTGAGCGCCGCCATCCGGCTCAAGCAGCTGGCGGCCGAACGCGATGACTTCCGTGTC
TTGGTGCTGGAAAAGGCCGGTGATGTCGGCGGTCATATCCTCTCCGGCGCCGTGCTGCAGCCCACGTCGCTCAGG
GAATTGCTACCCAACTGGATCGACGACGATAACCCTTCGCGATTCCAGCATGCTACGCCCGCGGGCGCCGACCAC
ATGCGCTTCCTCACCCGCTCGGCTGCCATCCCGCTACCGGCGCCGCCGCAGATGAGCAACCATGGAAACTACATC
GTCAGTCTCAACCAGTTCGTCAAGTGGCTCGGCGAGCAGGCCGAGGAGGCGGGCGTCGAGGTCTATCCCGGATTC
GCGGCCGCAGAAGTCCTGTACGGTCCGGACGGCTCTGTCAAGGGCGTCGCCACCAACGACGTGGGAATCGCTAAA
GATGGGCGCCGCAAGGATACCTTCCAGCCCGGAATGGAGTTTCACGCGCGCTTGACTCTCTTCGCCGAGGGCTGT
CACGGCAGCCTCAGCAAGCAGGTCATCAACAAGTTCGACCTACGAAAAGACAGCCAGCACCAGACGTACGGCCTC
GGCCTCAAGGAGCTTTGGGAGGTCGACCCGGCCAAGTTCGAGAGCGGCCGCGTCGTGCATGCCATGGGCTACCCA
CTGCCAAGGGACGTCTACGGCGGTTCCTTCATGTACCATTTTGGCGACAACCTCGTCTCGCTGGGGATGGTCGTC
TCGCTCGACTACCGCAACCCGTGGATGTCGCCCTACCAGGAGTTCCAGAAGCTGAAGCACCATCCGCTCTTCAGC
AGAGTCATCGAGGGCGGCAAGTGTATATCCTACGGCGCCCGCTCCCTGGTCGAGGGCGGGTTTCAGTCCATCCCA
AAGGTAGCCTTCCCCGGCGGCGCCCTCATCGGAGACTCTGCGGGCTTCGTCAACGTCCCCAAGGTCAAGGGCACC
CACAACGCCATCAAGTCGGGCATGCTGGCGGCCGAGGCGGCGTGGACGGCCCTGAGCCAGAGCAGCGACGGCACC
GTCTTTCTCTACGACTATGAGGACTCGCTCCGTCAGTCGTCCGTCTGGAAGGAGCTCAGGGAGGTGCGCAATATG
CGTCCCTCTTTCCACACGCCCCTGGGCGTATACGGCGGCTTGGCCTATTCCGGCCTCGAGGCCTTTCTTCTCAAG
GGCAGGTCACCCTGGACGCTGAAGCACAAAGAGCCTGACCATGCCGCCACCCAGCCGGCGGACCGGTATCCCAAG
ATCGACTACGAAAAGCCCGACGGCAAAATCAGCTTCGACATATTGACCAGCGTCTCCCGCACCGGAACCAATCAC
GAAGAGGACCAGCCGGTTCACCTACAGGTGGCCGACTGGGATGCTCACACCGACAAGGCCTATCCCGCCTTCAAG
GGGCTAGAGAACCGCTTCTGCCCGGCTGGCGTGTACGAATACGTCGAGGACGCGTCGAAGCCGCACGGGGTTAGG
TTCCAAATCAACGCCCAAAACTGCATCCACTGCAAGACGTGCGATATCAAGGCTCCTCAGCAAGATATCAACTGG
CAGGTGCCCCAGGGAGGCGAAGGCCCCAAGTACTACATGACTTGA
Transcript >Ophcf2|01211
ATGGCTGCCCCTTCAGCTGTCGTCGCCAGGTGCGCATCACGAGCCGCCATCGCCAGCCGATGCTGCACGCGCCCT
TCGTGCCGGACGCCGCTCCAGCCGGCGTTGACGACGACCGCGACGACCACGACGACCACGACGACCACGACGACC
TTGACCACGACCACGCTGCGATCCGTCCTCTCCGCCGCCGCTGGCAGCCGGCCCAGGCGATGGTTCAGCGCGGGC
GTCCCTCGGCGACGGCCAACGGACGAGCACGGAACCCCCGAACGCGAATCGGATCAGGTGGACGTGTGTATCGTC
GGCGGCGGACCTGCTGGCTTGAGCGCCGCCATCCGGCTCAAGCAGCTGGCGGCCGAACGCGATGACTTCCGTGTC
TTGGTGCTGGAAAAGGCCGGTGATGTCGGCGGTCATATCCTCTCCGGCGCCGTGCTGCAGCCCACGTCGCTCAGG
GAATTGCTACCCAACTGGATCGACGACGATAACCCTTCGCGATTCCAGCATGCTACGCCCGCGGGCGCCGACCAC
ATGCGCTTCCTCACCCGCTCGGCTGCCATCCCGCTACCGGCGCCGCCGCAGATGAGCAACCATGGAAACTACATC
GTCAGTCTCAACCAGTTCGTCAAGTGGCTCGGCGAGCAGGCCGAGGAGGCGGGCGTCGAGGTCTATCCCGGATTC
GCGGCCGCAGAAGTCCTGTACGGTCCGGACGGCTCTGTCAAGGGCGTCGCCACCAACGACGTGGGAATCGCTAAA
GATGGGCGCCGCAAGGATACCTTCCAGCCCGGAATGGAGTTTCACGCGCGCTTGACTCTCTTCGCCGAGGGCTGT
CACGGCAGCCTCAGCAAGCAGGTCATCAACAAGTTCGACCTACGAAAAGACAGCCAGCACCAGACGTACGGCCTC
GGCCTCAAGGAGCTTTGGGAGGTCGACCCGGCCAAGTTCGAGAGCGGCCGCGTCGTGCATGCCATGGGCTACCCA
CTGCCAAGGGACGTCTACGGCGGTTCCTTCATGTACCATTTTGGCGACAACCTCGTCTCGCTGGGGATGGTCGTC
TCGCTCGACTACCGCAACCCGTGGATGTCGCCCTACCAGGAGTTCCAGAAGCTGAAGCACCATCCGCTCTTCAGC
AGAGTCATCGAGGGCGGCAAGTGTATATCCTACGGCGCCCGCTCCCTGGTCGAGGGCGGGTTTCAGTCCATCCCA
AAGGTAGCCTTCCCCGGCGGCGCCCTCATCGGAGACTCTGCGGGCTTCGTCAACGTCCCCAAGGTCAAGGGCACC
CACAACGCCATCAAGTCGGGCATGCTGGCGGCCGAGGCGGCGTGGACGGCCCTGAGCCAGAGCAGCGACGGCACC
GTCTTTCTCTACGACTATGAGGACTCGCTCCGTCAGTCGTCCGTCTGGAAGGAGCTCAGGGAGGTGCGCAATATG
CGTCCCTCTTTCCACACGCCCCTGGGCGTATACGGCGGCTTGGCCTATTCCGGCCTCGAGGCCTTTCTTCTCAAG
GGCAGGTCACCCTGGACGCTGAAGCACAAAGAGCCTGACCATGCCGCCACCCAGCCGGCGGACCGGTATCCCAAG
ATCGACTACGAAAAGCCCGACGGCAAAATCAGCTTCGACATATTGACCAGCGTCTCCCGCACCGGAACCAATCAC
GAAGAGGACCAGCCGGTTCACCTACAGGTGGCCGACTGGGATGCTCACACCGACAAGGCCTATCCCGCCTTCAAG
GGGCTAGAGAACCGCTTCTGCCCGGCTGGCGTGTACGAATACGTCGAGGACGCGTCGAAGCCGCACGGGGTTAGG
TTCCAAATCAACGCCCAAAACTGCATCCACTGCAAGACGTGCGATATCAAGGCTCCTCAGCAAGATATCAACTGG
CAGGTGCCCCAGGGAGGCGAAGGCCCCAAGTACTACATGACTTGA
Gene >Ophcf2|01211
ATGGCTGCCCCTTCAGCTGTCGTCGCCAGGTGCGCATCACGAGCCGCCATCGCCAGCCGATGCTGCACGCGCCCT
TCGTGCCGGACGCCGCTCCAGCCGGCGTTGACGACGACCGCGACGACCACGACGACCACGACGACCACGACGACC
TTGACCACGACCACGCTGCGATCCGTCCTCTCCGCCGCCGCTGGCAGCCGGCCCAGGCGATGGTTCAGCGCGGGC
GTCCCTCGGCGACGGCCAACGGACGAGCACGGAACCCCCGAACGCGAATCGGATCAGGTGGACGTGTGTATCGTC
GGCGGCGGACCTGCTGGCTTGAGCGCCGCCATCCGGCTCAAGCAGCTGGCGGCCGAACGCGATGACTTCCGTGTC
TTGGTGCTGGAAAAGGCCGGTGATGTCGGCGGTCATATCCTCTCCGGCGCCGTGCTGCAGCCCACGTCGCTCAGG
GAATTGCTACCCAACTGGATCGACGACGATAACCCTTCGCGATTCCAGCATGCTACGCCCGCGGGCGCCGACCAC
ATGCGCTTCCTCACCCGCTCGGCTGCCATCCCGCTACCGGCGCCGCCGCAGATGAGCAACCATGGAAACTACATC
GTCAGTCTCAACCAGTTCGTCAAGTGGCTCGGCGAGCAGGCCGAGGAGGCGGGCGTCGAGGTCTATCCCGGATTC
GCGGCCGCAGAAGTCCTGTACGGTCCGGACGGCTCTGTCAAGGGCGTCGCCACCAACGACGTGGGAATCGCTAAA
GATGGGCGCCGCAAGGATACCTTCCAGCCCGGAATGGAGTTTCACGCGCGCTTGACTCTCTTCGCCGAGGGCTGT
CACGGCAGCCTCAGCAAGCAGGTCATCAACAAGTTCGACCTACGAAAAGACAGCCAGCACCAGACGTACGGCCTC
GGCCTCAAGGAGCTTTGGGAGGTCGACCCGGCCAAGTTCGAGAGCGGCCGCGTCGTGCATGCCATGGGCTACCCA
CTGCCAAGGGACGTCTACGGCGGTTCCTTCATGTACCATTTTGGCGACAACCTCGTCTCGCTGGGGATGGTCGTC
TCGCTCGACTACCGCAACCCGTGGATGTCGCCCTACCAGGAGTTCCAGAAGCTGAAGCACCATCCGCTCTTCAGC
AGAGTCATCGAGGGCGGCAAGTGTATATCCTACGGCGCCCGCTCCCTGGTCGAGGGCGGGTTTCAGTCCATCCCA
AAGGTAGCCTTCCCCGGCGGCGCCCTCATCGGAGACTCTGCGGGCTTCGTCAACGTCCCCAAGGTCAAGGGCACC
CACAACGCCATCAAGTCGGGCATGCTGGCGGCCGAGGCGGCGTGGACGGCCCTGAGCCAGAGCAGCGACGGCACC
GTCTTTCTCTACGACTATGAGGACTCGCTCCGTCAGTCGTCCGTCTGGAAGGAGCTCAGGGAGGTGCGCAATATG
CGTCCCTCTTTCCACACGCCCCTGGGCGTATACGGCGGCTTGGCCTATTCCGGCCTCGAGGCCTTTCTTCTCAAG
GGCAGGTCACCCTGGACGCTGAAGCACAAAGAGCCTGACCATGCCGCCACCCAGCCGGCGGACCGGTATCCCAAG
ATCGACTACGAAAAGCCCGACGGCAAAATCAGCTTCGACATATTGACCAGCGTCTCCCGCACCGGAACCAATCAC
GAAGAGGACCAGCCGGTTCACCTACAGGTGGCCGACTGGGATGCTCACACCGACAAGGCCTATCCCGCCTTCAAG
GGGCTAGAGAACCGCTTCTGCCCGGCTGGCGTGTACGAATACGTCGAGGACGCGTCGAAGCCGCACGGGGTTAGG
TTCCAAATCAACGCCCAAAAGTGAGACCCCTTTCCCTTTTGCTTACCTCCCGAAGACGAGCTGACGGGAGCAGCT
GCATCCACTGCAAGACGTGCGATATCAAGGCTCCTCAGCAAGATATCAACTGGCAGGTGCCCCAGGGAGGCGAAG
GCCCCAAGTACTACATGACTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail