Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01209
Gene name
Locationscaffold_01:4376901..4378332
Strand-
Gene length (bp)1431
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 1.2E-36 8 403

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7169 0.3227 0.1677 0.0279 0.1786 0.0218 0.1024 0.0793 0.4133 0.7007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4911
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5533
Ophiocordyceps australis map64 (Brazil) OphauB2|7095
Ophiocordyceps camponoti-floridani Ophcf2|01209 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1456
Ophiocordyceps kimflemingae Ophio5|5596
Ophiocordyceps subramaniannii Hirsu2|1456

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01209
MEEAPLSVLIVGSGVFGLSTAWSLTKQPFFDDTTITIVDCADHGRFPPPDAASVDHSRLIRPDYADGDYAALAMA
AQEEWRKQGDDDLGGQQRYAQSGLVLAADDSRAGGYVTRALDQVRKRCQNMTQNRDTSDNVRTFESKEALDEYLG
TDHAGDWGYLNTGSGWADAGKAMSWLYKRVEATQRVDFVGAKVKRLETRDDRVVGARLSDDKVLEAEVVLVAAGA
WTGELIDLRGRVEATGQPIGFVELTEQEAAIMAEQPSVLNLSTGLFVIPPRGRVLKVARHGFGYLNPRIVNSALP
ATTTAQMGPIMVSRPSTRRDVGDVYKLPAEADADLRRGLRDLTPIGGLETRPWKETRLCWYSDTKDGNWLIDWHP
EWKGLFVATGDSGHGFKFLPLLGDKVVDVMLGRGGDLGRKWMWRDSGEDGEGREIDGRFRGLRTLDQSRAGVAGM
VLEEELKKAEGTDGPPVEREVITGVL*
Coding >Ophcf2|01209
ATGGAAGAGGCGCCACTATCTGTCCTCATCGTTGGTTCAGGAGTCTTCGGGCTCAGCACGGCATGGTCGCTTACG
AAACAACCGTTCTTCGACGATACGACAATTACCATCGTCGATTGTGCTGACCATGGCCGGTTCCCTCCGCCAGAT
GCGGCCAGCGTGGACCATTCGAGGCTCATAAGGCCTGACTACGCAGACGGGGATTACGCAGCCTTGGCCATGGCC
GCGCAGGAGGAGTGGAGGAAGCAAGGCGACGATGACCTTGGTGGGCAGCAACGGTACGCTCAATCGGGGCTCGTC
CTCGCGGCGGATGACTCTCGAGCGGGCGGTTACGTGACTCGGGCGCTGGATCAGGTGCGGAAAAGATGCCAGAAC
ATGACGCAGAACAGAGACACGTCCGACAACGTCCGGACGTTTGAGAGCAAAGAGGCCCTTGACGAGTATCTGGGG
ACGGATCACGCCGGCGACTGGGGCTATCTCAACACGGGATCGGGCTGGGCTGACGCAGGAAAGGCCATGAGCTGG
TTGTACAAACGAGTCGAGGCCACTCAAAGAGTCGACTTTGTTGGTGCCAAGGTCAAACGGCTCGAGACGAGGGAT
GATAGGGTCGTTGGCGCGAGACTCTCCGACGACAAGGTGCTCGAGGCCGAGGTGGTGCTCGTTGCCGCCGGCGCC
TGGACCGGAGAATTGATCGATCTTCGGGGACGGGTCGAGGCCACTGGTCAACCAATCGGCTTCGTGGAACTCACA
GAGCAAGAGGCCGCCATCATGGCAGAGCAGCCGTCGGTGTTGAACCTGAGCACGGGACTCTTCGTCATCCCACCC
CGAGGGCGAGTCCTCAAGGTGGCACGACACGGCTTCGGCTACTTGAACCCCCGAATCGTCAACTCGGCGCTTCCA
GCGACGACGACAGCGCAGATGGGGCCCATAATGGTGTCACGACCTTCGACACGACGAGACGTCGGAGATGTCTAT
AAACTGCCCGCCGAAGCCGACGCTGACCTGCGACGTGGACTGCGGGACCTGACTCCCATCGGGGGCCTGGAGACG
CGGCCATGGAAGGAGACGCGGCTGTGCTGGTACTCGGACACCAAGGATGGAAACTGGCTCATCGACTGGCATCCC
GAGTGGAAGGGCCTGTTCGTCGCGACGGGGGACAGCGGCCACGGCTTCAAGTTCCTCCCCTTGCTGGGCGATAAG
GTCGTCGACGTCATGCTGGGACGAGGAGGCGATCTGGGCCGCAAGTGGATGTGGAGGGACAGTGGCGAAGATGGG
GAGGGAAGGGAGATTGATGGCAGGTTTCGTGGCTTGAGGACGCTGGACCAGAGCCGGGCGGGCGTCGCAGGCATG
GTGCTGGAGGAGGAGCTTAAGAAGGCTGAAGGGACGGATGGGCCCCCAGTAGAGAGGGAGGTCATCACTGGCGTG
TTGTAG
Transcript >Ophcf2|01209
ATGGAAGAGGCGCCACTATCTGTCCTCATCGTTGGTTCAGGAGTCTTCGGGCTCAGCACGGCATGGTCGCTTACG
AAACAACCGTTCTTCGACGATACGACAATTACCATCGTCGATTGTGCTGACCATGGCCGGTTCCCTCCGCCAGAT
GCGGCCAGCGTGGACCATTCGAGGCTCATAAGGCCTGACTACGCAGACGGGGATTACGCAGCCTTGGCCATGGCC
GCGCAGGAGGAGTGGAGGAAGCAAGGCGACGATGACCTTGGTGGGCAGCAACGGTACGCTCAATCGGGGCTCGTC
CTCGCGGCGGATGACTCTCGAGCGGGCGGTTACGTGACTCGGGCGCTGGATCAGGTGCGGAAAAGATGCCAGAAC
ATGACGCAGAACAGAGACACGTCCGACAACGTCCGGACGTTTGAGAGCAAAGAGGCCCTTGACGAGTATCTGGGG
ACGGATCACGCCGGCGACTGGGGCTATCTCAACACGGGATCGGGCTGGGCTGACGCAGGAAAGGCCATGAGCTGG
TTGTACAAACGAGTCGAGGCCACTCAAAGAGTCGACTTTGTTGGTGCCAAGGTCAAACGGCTCGAGACGAGGGAT
GATAGGGTCGTTGGCGCGAGACTCTCCGACGACAAGGTGCTCGAGGCCGAGGTGGTGCTCGTTGCCGCCGGCGCC
TGGACCGGAGAATTGATCGATCTTCGGGGACGGGTCGAGGCCACTGGTCAACCAATCGGCTTCGTGGAACTCACA
GAGCAAGAGGCCGCCATCATGGCAGAGCAGCCGTCGGTGTTGAACCTGAGCACGGGACTCTTCGTCATCCCACCC
CGAGGGCGAGTCCTCAAGGTGGCACGACACGGCTTCGGCTACTTGAACCCCCGAATCGTCAACTCGGCGCTTCCA
GCGACGACGACAGCGCAGATGGGGCCCATAATGGTGTCACGACCTTCGACACGACGAGACGTCGGAGATGTCTAT
AAACTGCCCGCCGAAGCCGACGCTGACCTGCGACGTGGACTGCGGGACCTGACTCCCATCGGGGGCCTGGAGACG
CGGCCATGGAAGGAGACGCGGCTGTGCTGGTACTCGGACACCAAGGATGGAAACTGGCTCATCGACTGGCATCCC
GAGTGGAAGGGCCTGTTCGTCGCGACGGGGGACAGCGGCCACGGCTTCAAGTTCCTCCCCTTGCTGGGCGATAAG
GTCGTCGACGTCATGCTGGGACGAGGAGGCGATCTGGGCCGCAAGTGGATGTGGAGGGACAGTGGCGAAGATGGG
GAGGGAAGGGAGATTGATGGCAGGTTTCGTGGCTTGAGGACGCTGGACCAGAGCCGGGCGGGCGTCGCAGGCATG
GTGCTGGAGGAGGAGCTTAAGAAGGCTGAAGGGACGGATGGGCCCCCAGTAGAGAGGGAGGTCATCACTGGCGTG
TTGTAG
Gene >Ophcf2|01209
ATGGAAGAGGCGCCACTATCTGTCCTCATCGTTGGTTCAGGAGTCTTCGGGCTCAGCACGGCATGGTCGCTTACG
AAACAACCGTTCTTCGACGATACGACAATTACCATCGTCGATTGTGCTGACCATGGCCGGTTCCCTCCGCCAGAT
GCGGCCAGCGTGGACCATTCGAGGCTCATAAGGCCTGACTACGCAGACGGGGATTACGCAGCCTTGGCCATGGCC
GCGCAGGAGGAGTGGAGGAAGCAAGGCGACGATGACCTTGGTGGGCAGCAACGGTACGCTCAATCGGGGCTCGTC
CTCGCGGCGGATGACTCTCGAGCGGGCGGTTACGTGACTCGGGCGCTGGATCAGGTGCGGAAAAGATGCCAGAAC
ATGACGCAGAACAGAGACACGTCCGACAACGTCCGGACGTTTGAGAGCAAAGAGGCCCTTGACGAGTATCTGGGG
ACGGATCACGCCGGCGACTGGGGCTATCTCAACACGGGATCGGGCTGGGCTGACGCAGGAAAGGCCATGAGCTGG
TTGTACAAACGAGTCGAGGCCACTCAAAGAGTCGACTTTGTTGGTGCCAAGGTCAAACGGCTCGAGACGAGGGAT
GATAGGGTCGTTGGCGCGAGACTCTCCGACGACAAGGTGCTCGAGGCCGAGGTGGTGCTCGTTGCCGCCGGCGCC
TGGACCGGAGAATTGATCGATCTTCGGGGACGGGTCGAGGCCACTGGTCAACCAATCGGCTTCGTGGAACTCACA
GAGCAAGAGGCCGCCATCATGGCAGAGCAGCCGTCGGTGTTGAACCTGAGCACGGGACTCTTCGTCATCCCACCC
CGAGGGCGAGTCCTCAAGGTGGCACGACACGGCTTCGGCTACTTGAACCCCCGAATCGTCAACTCGGCGCTTCCA
GCGACGACGACAGCGCAGATGGGGCCCATAATGGTGTCACGACCTTCGACACGACGAGACGTCGGAGATGTCTAT
AAACTGCCCGCCGAAGCCGACGCTGACCTGCGACGTGGACTGCGGGACCTGACTCCCATCGGGGGCCTGGAGACG
CGGCCATGGAAGGAGACGCGGCTGTGCTGGTACTCGGACACCAAGGATGGAAACTGGCTCATCGACTGGCATCCC
GAGTGGAAGGGCCTGTTCGTCGCGACGGGGGACAGCGGCCACGGCTTCAAGTTCCTCCCCTTGCTGGGCGATAAG
GTCGTCGACGTCATGCTGGGACGAGGAGGCGATCTGGGCCGCAAGTGGATGTGGAGGGACAGTGGCGAAGATGGG
GAGGGAAGGGAGATTGATGGCAGGTTTCGTGGCTTGAGGACGCTGGACCAGAGCCGGGCGGGCGTCGCAGGCATG
GTGCTGGAGGAGGAGCTTAAGAAGGCTGAAGGGACGGATGGGCCCCCAGTAGAGAGGGAGGTCATCACTGGCGTG
TTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail