Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01191
Gene name
Locationscaffold_01:4323279..4325129
Strand-
Gene length (bp)1850
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02752 Arrestin_C Arrestin (or S-antigen), C-terminal domain 2.9E-17 185 337
PF00339 Arrestin_N Arrestin (or S-antigen), N-terminal domain 9.1E-15 37 168

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6504 0.3628 0.0959 0.2699 0.1138 0.0009 0.061 0.2974 0.1898 0.0034

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2230
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6578
Ophiocordyceps australis map64 (Brazil) OphauB2|7078
Ophiocordyceps camponoti-floridani Ophcf2|01191 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1336
Ophiocordyceps kimflemingae Ophio5|702
Ophiocordyceps subramaniannii Hirsu2|2854

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01191
MPSFNPFSSVTGRNSYSLFDIRLDQDFIVFRGNDHESSGQLLKGVVVLCLSTLLRIEDVRLRLTGTLRLAWTDPR
SSTPGVSGQRVDRSTTILDHRWAPFIGTHGKSMTLPAGNYEYPFEFTLPGDTAESVEGIPEASITYRLKATVGRG
KLAYDLHAYKHLRVIRTLEPGALELLHAMSVENIWPNKVDYSIVIPHKAVVFGGTINMEMRFTPLLKGLELGEIT
AKFIELRDCWIQGSTGLSLREHHTEREVSHWKLHVNHQDHWHDMIDDTGQEGWTLKKPLKLPKRLRQCIQDLNHH
GIKVRHKIKLTVALKNPDGHISELRATLPVSIFISPNVPFDEQGNLMSQASGSSSLAGQDAAAMAPPGYGEHVLD
QLYEDVEPAGLQTPGLQSGVSSPFYAHSRTGSADNLAVMANNALMIAPAALSSRLADVSLDGPRRNSSYTSMHSD
LVPGRSEPASANLTRSNSREEQSRRNSAEHIEMDEVDFADLNRVPSYATAVRTPARLRPQTGTFAVPDYQTALHA
PRTPPGTDMGVAEQLTTIPEVAAPAGEQLRA*
Coding >Ophcf2|01191
ATGCCGTCCTTTAACCCCTTCTCATCGGTGACGGGACGCAACAGCTACAGCCTCTTTGATATCCGCCTCGACCAG
GACTTCATCGTCTTCCGCGGCAACGACCATGAATCGTCGGGCCAGCTGCTCAAAGGCGTCGTCGTCTTGTGCCTT
TCCACGCTCTTGCGCATAGAGGATGTCCGCCTGCGACTGACGGGCACTCTCCGCTTGGCTTGGACTGACCCAAGA
TCAAGTACCCCCGGCGTTTCGGGGCAGAGGGTCGACAGGTCCACCACGATACTCGATCACCGATGGGCCCCCTTT
ATCGGCACTCATGGCAAGAGCATGACGCTGCCCGCCGGCAACTACGAGTATCCCTTCGAGTTTACGCTGCCCGGT
GATACGGCCGAGAGCGTCGAGGGCATTCCCGAGGCGTCCATCACCTATCGCCTCAAGGCCACCGTCGGCCGCGGC
AAGCTCGCCTACGACCTGCACGCCTACAAGCACCTCCGCGTCATCCGCACCCTCGAGCCCGGCGCCCTCGAACTC
CTCCATGCCATGAGCGTCGAGAACATCTGGCCCAACAAGGTCGACTACTCCATCGTCATCCCCCACAAGGCCGTC
GTCTTTGGCGGCACCATCAACATGGAGATGCGCTTCACCCCGCTGCTCAAGGGACTAGAGCTGGGCGAGATCACG
GCCAAGTTCATTGAGTTGCGCGATTGCTGGATCCAGGGCTCCACGGGCCTCAGCCTGCGCGAGCACCACACCGAG
CGAGAGGTGTCGCACTGGAAGCTGCACGTCAACCACCAAGACCACTGGCACGACATGATCGACGACACCGGCCAG
GAGGGCTGGACGCTCAAGAAGCCGCTCAAGTTGCCCAAACGCCTGCGCCAGTGCATCCAGGACCTGAACCATCAC
GGCATCAAGGTCAGGCACAAGATCAAGCTGACGGTGGCGCTCAAGAACCCAGATGGTCACATATCCGAGTTGCGC
GCGACGCTCCCCGTGTCCATCTTCATCTCGCCCAATGTACCTTTTGACGAGCAGGGCAACCTCATGAGTCAGGCA
TCCGGATCGTCGTCTCTAGCCGGGCAAGATGCGGCCGCCATGGCGCCACCCGGCTACGGCGAGCACGTCCTCGAT
CAGCTCTACGAGGACGTCGAACCGGCCGGTCTCCAGACGCCGGGCCTGCAGTCGGGCGTCAGCAGCCCCTTTTAC
GCCCACTCACGAACGGGGTCGGCCGACAATCTGGCCGTCATGGCCAACAATGCGCTCATGATTGCGCCGGCGGCC
CTTTCGTCGCGGCTTGCCGACGTGTCGCTGGACGGGCCGCGGCGCAACAGCTCTTACACGTCGATGCACTCGGAC
CTGGTGCCGGGCCGGTCGGAGCCGGCGTCGGCCAATCTGACGAGGAGCAACAGCCGCGAAGAGCAGTCGCGGCGC
AACTCGGCGGAGCACATCGAGATGGACGAGGTCGACTTTGCCGACCTGAACCGAGTTCCGAGTTACGCGACGGCT
GTCCGGACGCCGGCCCGGTTGCGGCCCCAGACGGGCACCTTTGCCGTACCGGACTACCAGACGGCGCTCCACGCA
CCGCGCACGCCGCCGGGGACGGACATGGGTGTGGCCGAGCAGCTGACGACGATACCGGAGGTGGCGGCGCCGGCG
GGCGAACAGCTTCGTGCCTGA
Transcript >Ophcf2|01191
ATGCCGTCCTTTAACCCCTTCTCATCGGTGACGGGACGCAACAGCTACAGCCTCTTTGATATCCGCCTCGACCAG
GACTTCATCGTCTTCCGCGGCAACGACCATGAATCGTCGGGCCAGCTGCTCAAAGGCGTCGTCGTCTTGTGCCTT
TCCACGCTCTTGCGCATAGAGGATGTCCGCCTGCGACTGACGGGCACTCTCCGCTTGGCTTGGACTGACCCAAGA
TCAAGTACCCCCGGCGTTTCGGGGCAGAGGGTCGACAGGTCCACCACGATACTCGATCACCGATGGGCCCCCTTT
ATCGGCACTCATGGCAAGAGCATGACGCTGCCCGCCGGCAACTACGAGTATCCCTTCGAGTTTACGCTGCCCGGT
GATACGGCCGAGAGCGTCGAGGGCATTCCCGAGGCGTCCATCACCTATCGCCTCAAGGCCACCGTCGGCCGCGGC
AAGCTCGCCTACGACCTGCACGCCTACAAGCACCTCCGCGTCATCCGCACCCTCGAGCCCGGCGCCCTCGAACTC
CTCCATGCCATGAGCGTCGAGAACATCTGGCCCAACAAGGTCGACTACTCCATCGTCATCCCCCACAAGGCCGTC
GTCTTTGGCGGCACCATCAACATGGAGATGCGCTTCACCCCGCTGCTCAAGGGACTAGAGCTGGGCGAGATCACG
GCCAAGTTCATTGAGTTGCGCGATTGCTGGATCCAGGGCTCCACGGGCCTCAGCCTGCGCGAGCACCACACCGAG
CGAGAGGTGTCGCACTGGAAGCTGCACGTCAACCACCAAGACCACTGGCACGACATGATCGACGACACCGGCCAG
GAGGGCTGGACGCTCAAGAAGCCGCTCAAGTTGCCCAAACGCCTGCGCCAGTGCATCCAGGACCTGAACCATCAC
GGCATCAAGGTCAGGCACAAGATCAAGCTGACGGTGGCGCTCAAGAACCCAGATGGTCACATATCCGAGTTGCGC
GCGACGCTCCCCGTGTCCATCTTCATCTCGCCCAATGTACCTTTTGACGAGCAGGGCAACCTCATGAGTCAGGCA
TCCGGATCGTCGTCTCTAGCCGGGCAAGATGCGGCCGCCATGGCGCCACCCGGCTACGGCGAGCACGTCCTCGAT
CAGCTCTACGAGGACGTCGAACCGGCCGGTCTCCAGACGCCGGGCCTGCAGTCGGGCGTCAGCAGCCCCTTTTAC
GCCCACTCACGAACGGGGTCGGCCGACAATCTGGCCGTCATGGCCAACAATGCGCTCATGATTGCGCCGGCGGCC
CTTTCGTCGCGGCTTGCCGACGTGTCGCTGGACGGGCCGCGGCGCAACAGCTCTTACACGTCGATGCACTCGGAC
CTGGTGCCGGGCCGGTCGGAGCCGGCGTCGGCCAATCTGACGAGGAGCAACAGCCGCGAAGAGCAGTCGCGGCGC
AACTCGGCGGAGCACATCGAGATGGACGAGGTCGACTTTGCCGACCTGAACCGAGTTCCGAGTTACGCGACGGCT
GTCCGGACGCCGGCCCGGTTGCGGCCCCAGACGGGCACCTTTGCCGTACCGGACTACCAGACGGCGCTCCACGCA
CCGCGCACGCCGCCGGGGACGGACATGGGTGTGGCCGAGCAGCTGACGACGATACCGGAGGTGGCGGCGCCGGCG
GGCGAACAGCTTCGTGCCTGA
Gene >Ophcf2|01191
ATGCCGTCCTTTAACCCCTTCTCATCGGTGACGGGACGCAACAGCTACAGCCTCTTTGATATCCGGTGCGTCCAT
CTGCGTCCGTCCACGCCTTGTTCGTCTCACCACCTGACCTGGGCCCAGCCTCGACCAGGACTTCATCGTCTTCCG
CGGCAACGACCATGAATCGTCGGGCCAGCTGCTCAAAGGCGTCGTCGTCTTGTGCCTTTCCACGCTCTTGCGCAT
AGAGGATGTCCGCCTGCGACTGACGGGCACTCTCCGCTTGGCGTCAGTCGACTCACTCTTCTTCTCCTTCTTCCG
CTCTTGGTCTAACGCGCTCTTTCAGTTGGACTGACCCAAGATCAAGTACCCCCGGCGTTTCGGGGCAGAGGGTCG
ACAGGTCCACCACGATACTCGATCACCGATGGGCCCCCTTTATCGGCACTCATGGCAAGAGCATGACGCTGCCCG
CCGGCAACTACGAGTATCCCTTCGAGTTTACGCTGCCCGGTGATACGGCCGAGAGCGTCGAGGGCATTCCCGAGG
CGTCCATCACCTATCGCCTCAAGGCCACCGTCGGCCGCGGCAAGCTCGCCTACGACCTGCACGCCTACAAGCACC
TCCGCGTCATCCGCACCCTCGAGCCCGGCGCCCTCGAACTCCTCCATGCCATGAGCGTCGAGAACATCTGGCCCA
ACAAGGTCGACTACTCCATCGTCATCCCCCACAAGGCCGTCGTCTTTGGCGGCACCATCAACATGGAGATGCGCT
TCACCCCGCTGCTCAAGGGACTAGAGCTGGGCGAGATCACGGCCAAGTTCATTGAGTTGCGCGATTGCTGGATCC
AGGGCTCCACGGGCCTCAGCCTGCGCGAGCACCACACCGAGCGAGAGGTGTCGCACTGGAAGCTGCACGTCAACC
ACCAAGACCACTGGCACGACATGATCGACGACACCGGCCAGGAGGGCTGGACGCTCAAGAAGCCGCTCAAGTTGC
CCAAACGCCTGCGCCAGTGCATCCAGGACCTGAACCATCACGGCATCAAGGTCAGGCACAAGATCAAGCTGACGG
TGGCGCTCAAGAACCCAGATGGTCACATATCCGAGGTGAGAGCCGAAATTGACATCAACAAGAATTGCGTGATTT
AAGGCTAAATATACATGACCAAGTTGCGCGCGACGCTCCCCGTGTCCATCTTCATCTCGCCCAATGTACCTTTTG
ACGAGCAGGGCAACCTCATGAGTCAGGCATCCGGATCGTCGTCTCTAGCCGGGCAAGATGCGGCCGCCATGGCGC
CACCCGGCTACGGCGAGCACGTCCTCGATCAGCTCTACGAGGACGTCGAACCGGCCGGTCTCCAGACGCCGGGCC
TGCAGTCGGGCGTCAGCAGCCCCTTTTACGCCCACTCACGAACGGGGTCGGCCGACAATCTGGCCGTCATGGCCA
ACAATGCGCTCATGATTGCGCCGGCGGCCCTTTCGTCGCGGCTTGCCGACGTGTCGCTGGACGGGCCGCGGCGCA
ACAGCTCTTACACGTCGATGCACTCGGACCTGGTGCCGGGCCGGTCGGAGCCGGCGTCGGCCAATCTGACGAGGA
GCAACAGCCGCGAAGAGCAGTCGCGGCGCAACTCGGCGGAGCACATCGAGATGGACGAGGTCGACTTTGCCGACC
TGAACCGAGTTCCGAGTTACGCGACGGCTGTCCGGACGCCGGCCCGGTTGCGGCCCCAGACGGGCACCTTTGCCG
TACCGGACTACCAGACGGCGCTCCACGCACCGCGCACGCCGCCGGGGACGGACATGGGTGTGGCCGAGCAGCTGA
CGACGATACCGGAGGTGGCGGCGCCGGCGGGCGAACAGCTTCGTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail