Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01188
Gene name
Locationscaffold_01:4315940..4317191
Strand-
Gene length (bp)1251
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain 1.3E-32 10 143
PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain 5.5E-20 163 247

GO

GO Term Description Terminal node
GO:0006284 base-excision repair Yes
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds Yes
GO:0008270 zinc ion binding Yes
GO:0019104 DNA N-glycosylase activity Yes
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity Yes
GO:0003684 damaged DNA binding Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0005488 binding No
GO:0051716 cellular response to stimulus No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043169 cation binding No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0006281 DNA repair No
GO:0006950 response to stress No
GO:0006974 cellular response to DNA damage stimulus No
GO:0003677 DNA binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0016787 hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.204 0.9147 0.0617 0.0265 0.2421 0.1087 0.0367 0.0039 0.0351 0.0065

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2594
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6575
Ophiocordyceps australis map64 (Brazil) OphauB2|7076
Ophiocordyceps camponoti-floridani Ophcf2|01188 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3574
Ophiocordyceps kimflemingae Ophio5|6596
Ophiocordyceps subramaniannii Hirsu2|391

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01188
MPEIAEGNCLEVARIVHFLRKKLVGKRIASASAVDDANVFGKVGTSGSAVEKALNGNKVVSAGSQGKYFWITLEN
SPHVLMHFGMTGWVHIRGEMTAYTNYYKKMKDKEMNSWPPKFTKFHLTTVEEPVVEVAFTDPRRFGRVRLMDCPG
AEIRKHSPLVENGPDPVVDVDVFTEAYLRCKMRSRHVPIKALLLDQTTISGIGNWVADETLYHAKIHPEQHCDYL
DDAQVATLYRCIRYVCQTAVDELGDSDRFPDHWLFNHRWGKSRGLAKLPNGERLAFVTVGGRTSCYAPALQKLTA
GGRRAVSHDEPAEAPRPKKRRTKTNMETDDEQTPKAATPPRRSARLRKS*
Coding >Ophcf2|01188
ATGCCTGAGATAGCAGAAGGCAATTGTCTTGAAGTCGCCCGAATCGTGCATTTTCTCCGAAAGAAGCTGGTTGGC
AAGCGAATTGCGTCTGCCTCCGCCGTCGATGACGCGAATGTCTTTGGCAAGGTCGGGACAAGCGGCTCTGCCGTC
GAAAAGGCCCTCAATGGAAACAAGGTGGTGTCGGCTGGCAGCCAGGGCAAGTACTTTTGGATTACGCTTGAAAAT
TCTCCTCATGTATTGATGCATTTTGGCATGACTGGCTGGGTCCATATCCGAGGCGAGATGACGGCGTACACCAAC
TACTACAAGAAGATGAAGGACAAAGAAATGAACTCATGGCCGCCCAAGTTCACCAAGTTCCACCTGACGACGGTC
GAAGAGCCGGTCGTCGAGGTGGCCTTCACCGATCCACGGAGGTTCGGCCGCGTGAGGCTGATGGACTGCCCCGGA
GCCGAGATCCGCAAGCACTCGCCGCTGGTAGAAAACGGGCCTGACCCCGTCGTCGACGTCGACGTCTTCACAGAA
GCCTACCTACGATGCAAGATGCGGTCACGGCACGTCCCCATCAAGGCCCTGCTCCTGGATCAGACAACCATCAGC
GGCATCGGAAACTGGGTCGCCGACGAGACGCTCTACCACGCAAAGATCCACCCGGAACAACATTGCGACTACCTG
GACGACGCGCAGGTGGCGACGCTCTACCGTTGCATCCGCTACGTCTGCCAGACAGCCGTCGACGAGCTCGGCGAC
TCGGACCGCTTCCCAGACCACTGGCTCTTCAACCATCGCTGGGGTAAGAGCCGCGGCCTGGCCAAGCTGCCCAAC
GGTGAGCGGCTGGCCTTTGTCACCGTCGGCGGCCGAACCAGCTGCTATGCGCCCGCGTTGCAGAAGCTGACGGCG
GGCGGGCGTCGTGCCGTCTCTCATGACGAACCGGCCGAGGCACCTCGTCCCAAGAAGAGACGGACAAAGACAAAC
ATGGAGACGGACGACGAGCAGACGCCCAAGGCAGCCACGCCGCCCAGGCGATCTGCCCGGCTCCGGAAGAGCTAG
Transcript >Ophcf2|01188
ATGCCTGAGATAGCAGAAGGCAATTGTCTTGAAGTCGCCCGAATCGTGCATTTTCTCCGAAAGAAGCTGGTTGGC
AAGCGAATTGCGTCTGCCTCCGCCGTCGATGACGCGAATGTCTTTGGCAAGGTCGGGACAAGCGGCTCTGCCGTC
GAAAAGGCCCTCAATGGAAACAAGGTGGTGTCGGCTGGCAGCCAGGGCAAGTACTTTTGGATTACGCTTGAAAAT
TCTCCTCATGTATTGATGCATTTTGGCATGACTGGCTGGGTCCATATCCGAGGCGAGATGACGGCGTACACCAAC
TACTACAAGAAGATGAAGGACAAAGAAATGAACTCATGGCCGCCCAAGTTCACCAAGTTCCACCTGACGACGGTC
GAAGAGCCGGTCGTCGAGGTGGCCTTCACCGATCCACGGAGGTTCGGCCGCGTGAGGCTGATGGACTGCCCCGGA
GCCGAGATCCGCAAGCACTCGCCGCTGGTAGAAAACGGGCCTGACCCCGTCGTCGACGTCGACGTCTTCACAGAA
GCCTACCTACGATGCAAGATGCGGTCACGGCACGTCCCCATCAAGGCCCTGCTCCTGGATCAGACAACCATCAGC
GGCATCGGAAACTGGGTCGCCGACGAGACGCTCTACCACGCAAAGATCCACCCGGAACAACATTGCGACTACCTG
GACGACGCGCAGGTGGCGACGCTCTACCGTTGCATCCGCTACGTCTGCCAGACAGCCGTCGACGAGCTCGGCGAC
TCGGACCGCTTCCCAGACCACTGGCTCTTCAACCATCGCTGGGGTAAGAGCCGCGGCCTGGCCAAGCTGCCCAAC
GGTGAGCGGCTGGCCTTTGTCACCGTCGGCGGCCGAACCAGCTGCTATGCGCCCGCGTTGCAGAAGCTGACGGCG
GGCGGGCGTCGTGCCGTCTCTCATGACGAACCGGCCGAGGCACCTCGTCCCAAGAAGAGACGGACAAAGACAAAC
ATGGAGACGGACGACGAGCAGACGCCCAAGGCAGCCACGCCGCCCAGGCGATCTGCCCGGCTCCGGAAGAGCTAG
Gene >Ophcf2|01188
ATGCCTGAGATAGCAGAAGGCAAGTGATAGCAGATATCTTCGGATCAATTGTCACTGACAGTTGTCTTGAAGTCG
CCCGAATCGTGCATTTTCTCCGAAAGAAGCTGGTTGGCAAGCGAATTGCGTCTGCCTCCGCCGTCGATGACGCGA
ATGTCTTTGGCAAGGTCGGGACAAGCGGCTCTGCCGTCGAAAAGGCCCTCAATGGAAACAAGGTGTGGAAGGAGT
CTGAGATTACCCTTTCATCTCAGTCATCATTGACACGCGGTTCAGGTGGTGTCGGCTGGCAGCCAGGGCAAGTAC
TTTTGGTGAGCTTTACAACCGAGTCCTCTCGGGACCTCGTTGCTGATCTATCTATCTTAGGATTACGCTTGAAAA
TTCTCCTCATGTATTGATGCATTTTGGCATGACTGGTAGGAACGGTCTGAACCAACTACAGCTGGTCCGTCACTC
ACCGTCGCAGGCTGGGTCCATATCCGAGGCGAGATGACGGCGTACACCAACTACTACAAGAAGATGAAGGACAAA
GAAATGAACTCATGGCCGCCCAAGTTCACCAAGTTCCACCTGACGACGGTCGAAGAGCCGGTCGTCGAGGTGGCC
TTCACCGATCCACGGAGGTTCGGCCGCGTGAGGCTGATGGACTGCCCCGGAGCCGAGATCCGCAAGCACTCGCCG
CTGGTAGAAAACGGGCCTGACCCCGTCGTCGACGTCGACGTCTTCACAGAAGCCTACCTACGATGCAAGATGCGG
TCACGGCACGTCCCCATCAAGGCCCTGCTCCTGGATCAGACAACCATCAGCGGCATCGGAAACTGGGTCGCCGAC
GAGACGCTCTACCACGCAAAGATCCACCCGGAACAACATTGCGACTACCTGGACGACGCGCAGGTGGCGACGCTC
TACCGTTGCATCCGCTACGTCTGCCAGACAGCCGTCGACGAGCTCGGCGACTCGGACCGCTTCCCAGACCACTGG
CTCTTCAACCATCGCTGGGGTAAGAGCCGCGGCCTGGCCAAGCTGCCCAACGGTGAGCGGCTGGCCTTTGTCACC
GTCGGCGGCCGAACCAGCTGCTATGCGCCCGCGTTGCAGAAGCTGACGGCGGGCGGGCGTCGTGCCGTCTCTCAT
GACGAACCGGCCGAGGCACCTCGTCCCAAGAAGAGACGGACAAAGACAAACATGGAGACGGACGACGAGCAGACG
CCCAAGGCAGCCACGCCGCCCAGGCGATCTGCCCGGCTCCGGAAGAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail