Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01183
Gene name
Locationscaffold_01:4305647..4306427
Strand-
Gene length (bp)780
Transcript length (bp)633
Coding sequence length (bp)633
Protein length (aa) 211

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00926 DHBP_synthase 3,4-dihydroxy-2-butanone 4-phosphate synthase 1.5E-20 21 75
PF00926 DHBP_synthase 3,4-dihydroxy-2-butanone 4-phosphate synthase 2.3E-36 87 194

GO

GO Term Description Terminal node
GO:0008686 3,4-dihydroxy-2-butanone-4-phosphate synthase activity Yes
GO:0009231 riboflavin biosynthetic process Yes
GO:0042727 flavin-containing compound biosynthetic process No
GO:0003824 catalytic activity No
GO:0018130 heterocycle biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0009110 vitamin biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006767 water-soluble vitamin metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044283 small molecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0016830 carbon-carbon lyase activity No
GO:0042726 flavin-containing compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006766 vitamin metabolic process No
GO:0008150 biological_process No
GO:0016829 lyase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0006771 riboflavin metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.6763 0.4918 0.0101 0.0949 0.4418 0.0593 0.1641 0.0721 0.068 0.092

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5939
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6570
Ophiocordyceps australis map64 (Brazil) OphauB2|7071
Ophiocordyceps camponoti-floridani Ophcf2|01183 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3579
Ophiocordyceps kimflemingae Ophio5|7772

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01183
MPAPTAPPPTMANSLFDSIPDSIEAFRNGEFLVVLDDPDRENEADLIIAAQHVTTDRMAWMIRYSSGYICAPIPP
PAPTPSPSPSCAQDRARACRVLADPTAGPHHLRRPGHLLPLRAHPGGVRARRGHTEAALELCRLAGLEPAAAICE
IVDDGQEVPGRAVREGAGMMRGEACIAFARKWGLKVCTIADLVQHVDGVEGKLTANGDSA*
Coding >Ophcf2|01183
ATGCCTGCCCCGACAGCACCCCCCCCGACGATGGCAAACAGTCTCTTCGACTCCATCCCCGACTCCATCGAAGCC
TTCCGAAACGGCGAATTCCTCGTCGTCCTCGATGACCCCGACCGCGAAAACGAAGCAGACCTCATCATCGCCGCC
CAGCACGTCACCACCGACCGAATGGCCTGGATGATCCGCTACTCATCAGGCTACATCTGCGCGCCCATCCCCCCC
CCCGCGCCGACGCCCTCTCCCTCCCCCTCATGCGCCCAAGACCGCGCCCGCGCCTGCCGCGTCCTCGCCGACCCG
ACCGCCGGTCCTCATCATCTCCGCCGCCCGGGACATCTCCTCCCGCTGCGGGCCCATCCCGGCGGCGTCCGGGCG
AGAAGGGGCCATACCGAGGCCGCGCTCGAGCTGTGTCGCCTTGCTGGCTTGGAACCCGCGGCTGCCATCTGCGAG
ATCGTCGACGACGGCCAAGAGGTTCCCGGCCGGGCCGTTCGCGAGGGCGCGGGCATGATGAGGGGCGAGGCATGC
ATAGCCTTTGCCCGCAAGTGGGGGCTCAAGGTCTGCACCATCGCCGACCTCGTCCAGCATGTAGATGGCGTTGAG
GGCAAGCTGACCGCCAACGGCGACTCCGCTTGA
Transcript >Ophcf2|01183
ATGCCTGCCCCGACAGCACCCCCCCCGACGATGGCAAACAGTCTCTTCGACTCCATCCCCGACTCCATCGAAGCC
TTCCGAAACGGCGAATTCCTCGTCGTCCTCGATGACCCCGACCGCGAAAACGAAGCAGACCTCATCATCGCCGCC
CAGCACGTCACCACCGACCGAATGGCCTGGATGATCCGCTACTCATCAGGCTACATCTGCGCGCCCATCCCCCCC
CCCGCGCCGACGCCCTCTCCCTCCCCCTCATGCGCCCAAGACCGCGCCCGCGCCTGCCGCGTCCTCGCCGACCCG
ACCGCCGGTCCTCATCATCTCCGCCGCCCGGGACATCTCCTCCCGCTGCGGGCCCATCCCGGCGGCGTCCGGGCG
AGAAGGGGCCATACCGAGGCCGCGCTCGAGCTGTGTCGCCTTGCTGGCTTGGAACCCGCGGCTGCCATCTGCGAG
ATCGTCGACGACGGCCAAGAGGTTCCCGGCCGGGCCGTTCGCGAGGGCGCGGGCATGATGAGGGGCGAGGCATGC
ATAGCCTTTGCCCGCAAGTGGGGGCTCAAGGTCTGCACCATCGCCGACCTCGTCCAGCATGTAGATGGCGTTGAG
GGCAAGCTGACCGCCAACGGCGACTCCGCTTGA
Gene >Ophcf2|01183
ATGCCTGCCCCGACAGCACCCCCCCCGACGATGGCAAACAGTCTCTTCGACTCCATCCCCGACTCCATCGAAGCC
TTCCGTACGAGCCTACATCCCCCAAGCAAAGCCAGACAGACAGACAATCCAGCTAACGAGGCAAGGAAACGGCGA
ATTCCTCGTCGTCCTCGATGACCCCGACCGCGAAAACGAAGCAGACCTCATCATCGCCGCCCAGCACGTCACCAC
CGACCGAATGGCCTGGATGATCCGCTACTCATCAGGCTACATCTGCGCGCCCATCCCCCCCCCCGCGCCGACGCC
CTCTCCCTCCCCCTCATGGTCCCCTCCGGAAGCCAAGATCCCCGCGGCACCGCCTACACCATCTCCGTCGACGCC
GCCCACGCCTCCGTCACCACGGGAATCAGCGCCCAAGACCGCGCCCGCGCCTGCCGCGTCCTCGCCGACCCGACC
GCCGGTCCTCATCATCTCCGCCGCCCGGGACATCTCCTCCCGCTGCGGGCCCATCCCGGCGGCGTCCGGGCGAGA
AGGGGCCATACCGAGGCCGCGCTCGAGCTGTGTCGCCTTGCTGGCTTGGAACCCGCGGCTGCCATCTGCGAGATC
GTCGACGACGGCCAAGAGGTTCCCGGCCGGGCCGTTCGCGAGGGCGCGGGCATGATGAGGGGCGAGGCATGCATA
GCCTTTGCCCGCAAGTGGGGGCTCAAGGTCTGCACCATCGCCGACCTCGTCCAGCATGTAGATGGCGTTGAGGGC
AAGCTGACCGCCAACGGCGACTCCGCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail