Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01169
Gene name
Locationscaffold_01:4252206..4259014
Strand+
Gene length (bp)6808
Transcript length (bp)6624
Coding sequence length (bp)6624
Protein length (aa) 2208

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04054 Not1 CCR4-Not complex component, Not1 2.7E-126 1833 2203
PF16415 CNOT1_CAF1_bind CCR4-NOT transcription complex subunit 1 CAF1-binding domain 1.2E-90 919 1139
PF12842 DUF3819 CCR4-Not complex, Not1 subunit, domain of unknown function DUF3819 3.8E-46 1200 1338
PF16417 CNOT1_TTP_bind CCR4-NOT transcription complex subunit 1 TTP binding domain 3.7E-40 707 853
PF16418 CNOT1_HEAT CCR4-NOT transcription complex subunit 1 HEAT repeat 8.0E-37 516 663

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.5371 0.5167 0.2232 0.0763 0.0492 0.0048 0.2558 0.2094 0.2933 0.0044

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
CCR4-Not complex component, Not1

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3127
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5463
Ophiocordyceps australis map64 (Brazil) OphauB2|7053
Ophiocordyceps camponoti-floridani Ophcf2|01169 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2206
Ophiocordyceps kimflemingae Ophio5|4647
Ophiocordyceps subramaniannii Hirsu2|5490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01169
MVPPPRAGSFSPNPAQTLQTGTGHSPHPSHAGVLSAGASPSTSSPTGTNSLTKIVVAQVYLLLSTIKEDKDRAKW
EIQVDQLRKLIDEHGMEVFSKYFTRLVAGNAPQIFPGLNRPVANPGNYHILAAEMRKIAHDTGQAGKIAESVESG
TEDIFRDFDLSTFMEHFKLDALEKTLLALAFKTGSRPDLKTKADAILSTNFSSFMDIMSRPDIEAHADLTPASVA
FIVDRFLQYHPPSFNASSRRDLHTYVVKRYVSMDQPPPSQVLAALDIGRVLADRPANVLARYIQRTGADFTRDEE
TCFSYLQSRPSSMQLSPDQVSAALIFTAITQSPPHDPSVLTAALQRVLPKSFEWNEVIMFFDQPSARISSSQFLR
LYKALLPIAQDTKRNLDIQRLWGGSWSEPEAQLSFVSAYGSLTPDQLDATTIPRLHRSINIEDYANASPGLQERA
AVAVKHPLVSVAALSAIFNVALNSVHASQSVEAKRLFQEVVVPNLDIFLVSAFEVPRQSWATMAVDTLNSLFENF
FYKRSPEYEFVLDSLWKKDREWVVQRLIDAHAVKPIDLPLVYEHAVKLGWLDDLVYLPNGFGIDLAAYAHSQGHL
DLANWARFNADRSAEIARTLLQFLMIKANLEIQFQRPPDGQPAVKTSTSLQVRTVSALLQILEDFLPGAPVQDLI
LVQRHCITAYPRLINYGEGYDDVIDANGRDGNALPQAANSKMEEHYKKMYGDELQVRTIVEILDRYKRSREPLDQ
DAFACMIHGLFDEYNHYVDYPLEALATTAVLFGGIISHKLIAELPLQIGLGMILEAVRDHMPDDPMHKFGLQALM
QLLVRFREWPGFCEQLLQIPGLRGTEAYKKAEEIVRDHEKEVARSRNGAGTPRGLNFAGDSFVNGNTDEPVASDR
QAPPFAAIGVEAVPVGADFEEPGDEEQGKIQFVLNNITEGTLQSMRNELREMLERKHQQWFAGHLVEERAKMQPN
YHHVYLELVKLFEDNVLWSEVLRETFISVARMLNSELTMQNSTERTHLKNLGGWLGLLTLARDKPIKHKNIAFKQ
LLMEAHDTKRLIVVIPFVCKVLIQGATSQVFRPPNPWLMDIIHLLIELYHHAELKLNLKFEIEVLCKGLNLDHKS
IEPSGEILNRPSAEDVVESLPQGQMDAFENLSLNGIGSVVGSGLSPQAVAPTIPDVGPLITIPPTNEMVVSTSRL
HEIVAAALTNALQDIIQPVVDRSITIAAISTVQMIRKDFVSEPDENRLRTSAVNMVKATAGSLALVTSKEPLRAN
MTNYMRNLANDLPSGLPEGTIIMCVNSNLDLACSIIEKQAEERAVPEIEDLLEEDMAARRRHRIQQPNEPFYSGN
VNRWGMTIPNPYKLSPNVNGLNPEQMAIYEDFARQPRNATASGPSHAPSTSDATRSLANEVLQESYNAVPSLPAP
SETSSMPHMGPQLQPYGPIHAAANNLAGGRATSFQMDVRGLADRVNKLLQELMRVSGEAREEHFAGLPKPHPVLD
VVDALVQLIIKTSQNSEEFAIYAAEQISNLVFQQVDDNLALESLVHVLETLRKISGPALNNRVRAIFSQQPGSTF
LSIPLLETLFRTDLIEWRNLDLAMSQVVESRKEGSLEFLEHMLDLALLNERPMALYADFARTLEMAWAWICEDGG
SAAGQRLKSKLMGSPALPLASRSPDGDEAAAAAAAAAAAAAAAAARQDQLEYVFEEWVHLCNNPNASAKATIFFL
QQLQAKQMIRGRDDLFVFIRVALDLAVDRFEHVPPQSRSGVESKYSMTDALAKLMTMFLTMHSEGPTARTGLLDS
MLVLVGLVLSHHHAKRADHLNQRVFFRLLSMMLYDVQNMSDEVSEEEQRQMIVKFAKRFQFMGPLRLPGFAFSWL
GLVQHRAFLPVLMQIPGGGGWEPCLKLVVQLLSCLGEQLKTLNVSPVTKELYRGTLKFLIVLQHDFPDFLAASHM
KLAASIPAHCTQLLNTVLAANPQQHFGKLPDPLHAGLKVDRMEDMKTHPGLVEEAVSTLRECGLLSVLDQVLQSG
PTEDAVAQMAHAMTHRVPEQTAFGHVAVAANVEVIGAVVIYTGQHAAGRATTASTAISVGSGDPDVSVLSLLVHE
LPPEARYYLLSSMANQLRFPCAHTEYFSQLILYMFGKDLNDPEESEIRQEITRVLLERLVGFWPQPWGLMFTILE
LVKNDKYMFFELPFVKSTPEVADRFAAVLQRP*
Coding >Ophcf2|01169
ATGGTCCCTCCACCACGAGCGGGATCCTTTTCGCCAAATCCTGCACAGACTCTCCAGACGGGCACCGGGCACTCG
CCGCATCCCTCCCACGCTGGCGTCCTGAGTGCTGGCGCCAGCCCCAGCACCAGCAGCCCGACTGGGACCAACTCT
CTGACCAAGATCGTCGTGGCCCAGGTCTATCTTCTTCTCAGCACCATCAAGGAGGACAAGGACCGTGCCAAGTGG
GAAATCCAGGTGGATCAGTTACGAAAGCTCATCGATGAACACGGCATGGAAGTCTTTTCCAAGTATTTTACCCGT
CTGGTAGCGGGGAATGCGCCCCAGATATTCCCCGGCCTCAACAGGCCGGTTGCGAACCCGGGAAACTACCACATT
CTCGCCGCCGAGATGCGCAAAATCGCCCATGACACCGGTCAAGCTGGCAAGATAGCCGAGTCGGTCGAGAGCGGC
ACTGAGGACATCTTCCGTGACTTCGACCTCTCTACCTTTATGGAGCATTTCAAGCTCGATGCGCTCGAGAAGACT
CTACTGGCCCTGGCGTTCAAAACGGGCTCACGGCCCGACCTCAAGACGAAAGCCGATGCCATCCTGTCGACGAAT
TTTTCGTCCTTCATGGACATCATGTCGCGCCCCGATATCGAGGCGCATGCGGATCTCACGCCGGCCTCTGTAGCC
TTCATCGTCGATCGATTCCTCCAATACCACCCTCCTAGCTTTAATGCTTCGTCCAGACGGGACCTTCATACTTAC
GTCGTCAAGCGGTACGTCAGTATGGATCAACCGCCCCCTTCCCAGGTCCTCGCCGCCCTCGATATAGGCAGGGTC
CTTGCCGATAGGCCGGCAAACGTCTTGGCTCGATATATCCAGAGGACCGGCGCCGACTTCACCCGCGATGAGGAG
ACGTGCTTCTCCTACTTGCAGAGTCGCCCAAGCAGCATGCAGCTCAGCCCTGATCAGGTCTCCGCGGCGCTCATC
TTCACGGCAATCACTCAGAGCCCCCCCCACGACCCGTCGGTGCTCACTGCGGCCCTCCAGCGCGTGCTCCCCAAG
TCGTTTGAGTGGAACGAGGTCATCATGTTCTTCGACCAGCCATCGGCACGCATCTCGTCGTCGCAGTTCCTGCGC
CTCTACAAGGCCTTGCTGCCCATCGCTCAGGACACCAAGCGTAACTTGGACATTCAGCGGCTCTGGGGAGGCTCG
TGGAGCGAGCCCGAGGCCCAGCTGTCCTTTGTCAGTGCTTACGGTTCCTTGACGCCTGACCAGCTCGATGCGACG
ACGATCCCCCGCCTGCACCGAAGCATCAACATCGAAGACTACGCCAACGCTTCGCCCGGCCTGCAGGAGCGAGCC
GCGGTGGCCGTCAAGCATCCGCTGGTCTCCGTCGCCGCCCTCTCCGCCATCTTCAACGTTGCCCTCAACTCGGTT
CATGCCTCGCAAAGTGTCGAGGCTAAGCGTCTGTTTCAGGAGGTGGTGGTGCCGAACCTCGACATCTTTCTCGTG
TCTGCCTTTGAGGTTCCGCGACAGTCGTGGGCGACAATGGCCGTCGACACGCTCAACTCGCTCTTCGAGAACTTC
TTCTACAAGCGATCACCGGAATACGAATTCGTGCTCGATAGCCTGTGGAAGAAGGATCGTGAATGGGTCGTCCAG
CGCCTCATCGACGCCCACGCCGTGAAGCCCATCGACTTGCCTTTGGTCTACGAGCACGCCGTGAAACTGGGCTGG
CTCGATGACTTGGTCTATCTCCCCAATGGTTTCGGCATCGACCTCGCCGCATATGCACACTCCCAGGGCCATCTG
GACCTGGCTAACTGGGCGCGGTTCAACGCCGACAGGAGCGCCGAGATTGCGCGTACCTTGCTGCAGTTTCTGATG
ATCAAGGCCAACCTAGAGATTCAGTTTCAGCGACCGCCCGATGGTCAGCCCGCGGTGAAGACGAGCACTAGCTTG
CAGGTCCGGACCGTCTCTGCCCTGCTGCAGATACTCGAAGACTTCCTTCCGGGTGCTCCGGTTCAGGACCTCATT
CTTGTACAACGTCACTGTATCACCGCGTACCCGCGACTCATCAACTACGGCGAAGGCTACGACGACGTCATCGAC
GCGAATGGCAGGGATGGGAACGCCTTGCCGCAAGCCGCTAACAGCAAGATGGAGGAGCACTACAAGAAGATGTAC
GGCGACGAACTGCAGGTCCGCACGATTGTAGAGATATTGGACCGCTACAAGCGTTCGCGGGAGCCTCTTGACCAG
GACGCTTTTGCCTGCATGATTCATGGCCTCTTCGACGAGTATAACCACTACGTGGACTACCCATTGGAGGCTCTC
GCCACGACTGCGGTCCTGTTCGGCGGCATTATCTCTCACAAGCTGATTGCAGAACTCCCCCTGCAGATCGGCCTG
GGCATGATCCTCGAAGCGGTCAGGGATCACATGCCCGACGACCCCATGCACAAGTTCGGTCTACAGGCCCTGATG
CAGCTCCTGGTCCGGTTCAGGGAGTGGCCCGGCTTCTGCGAGCAACTGCTGCAGATCCCCGGCTTGCGTGGCACG
GAGGCCTACAAAAAGGCCGAGGAGATTGTCAGGGATCATGAGAAGGAGGTGGCGCGTTCGCGCAACGGCGCCGGC
ACGCCGCGTGGCCTGAATTTCGCGGGCGACTCTTTCGTTAACGGCAATACGGACGAGCCCGTGGCCAGCGATCGC
CAAGCTCCTCCGTTCGCGGCCATTGGGGTCGAGGCCGTACCCGTCGGCGCCGATTTCGAGGAGCCCGGCGACGAG
GAGCAGGGCAAGATACAGTTCGTTCTGAACAACATCACTGAGGGCACTCTGCAGTCGATGCGCAACGAGCTGCGT
GAGATGCTGGAACGCAAGCACCAGCAGTGGTTTGCCGGCCATCTCGTCGAGGAGCGCGCCAAGATGCAACCCAAC
TACCACCACGTCTACCTGGAGCTCGTGAAGCTCTTCGAGGACAACGTCTTATGGAGCGAAGTCCTCCGCGAGACG
TTCATCAGCGTGGCCCGGATGCTCAACTCGGAACTGACGATGCAGAATTCGACGGAGAGAACCCATCTTAAAAAC
CTTGGGGGCTGGCTTGGCCTCCTGACTCTGGCCCGAGACAAGCCGATCAAACACAAGAACATCGCCTTCAAGCAG
CTCCTGATGGAGGCGCACGACACCAAGAGGCTGATTGTTGTCATACCCTTCGTCTGCAAGGTGCTGATCCAAGGC
GCCACGTCGCAAGTTTTTCGGCCCCCGAACCCGTGGCTGATGGACATTATTCATCTCCTGATCGAGCTGTACCAT
CACGCCGAACTCAAGTTGAACCTCAAATTCGAGATTGAGGTTCTCTGCAAGGGGTTGAATCTCGACCACAAGAGT
ATCGAACCGTCGGGCGAGATTTTGAACCGGCCGTCGGCTGAGGATGTCGTCGAAAGCCTACCGCAAGGCCAGATG
GACGCTTTCGAAAACCTGTCGCTGAACGGAATCGGGTCCGTAGTCGGCTCGGGTCTCTCTCCGCAGGCCGTCGCA
CCCACCATCCCGGACGTCGGCCCCCTGATCACCATCCCGCCGACAAACGAGATGGTGGTCAGCACGTCGCGCCTG
CACGAGATTGTGGCGGCGGCCCTGACGAACGCCTTGCAAGATATCATCCAGCCCGTCGTGGACAGGTCCATAACG
ATAGCAGCGATATCCACCGTGCAGATGATACGCAAGGACTTCGTTTCGGAGCCCGACGAGAACCGGCTCCGAACG
TCGGCCGTCAATATGGTTAAGGCGACAGCGGGCAGCCTGGCCCTCGTGACGTCAAAGGAGCCTCTACGCGCAAAT
ATGACGAATTACATGCGGAATCTGGCCAACGACCTGCCTTCGGGCCTTCCTGAGGGGACCATCATAATGTGTGTC
AACTCGAACCTAGATTTGGCATGCAGCATCATCGAAAAGCAAGCCGAGGAGCGGGCAGTGCCGGAAATCGAAGAC
CTGCTGGAGGAAGACATGGCAGCACGGAGGCGACACCGCATCCAACAGCCAAACGAGCCCTTTTACTCGGGCAAC
GTCAATCGTTGGGGCATGACGATTCCGAATCCGTACAAGCTGTCGCCCAACGTCAACGGTCTCAACCCAGAGCAG
ATGGCCATTTACGAGGACTTCGCTAGACAGCCGCGAAACGCCACGGCCTCGGGGCCCTCACACGCTCCCTCGACG
TCCGACGCCACCCGCTCCCTGGCGAACGAGGTGCTGCAGGAGTCGTACAATGCTGTGCCGTCCCTTCCCGCTCCG
AGCGAGACGTCGTCGATGCCGCACATGGGACCGCAGCTGCAGCCTTACGGCCCGATCCACGCGGCCGCCAACAAC
CTGGCAGGCGGGCGGGCGACCAGCTTCCAGATGGACGTGCGAGGCCTGGCTGATCGCGTCAATAAGCTTCTTCAA
GAGCTGATGCGTGTTTCGGGAGAGGCTCGGGAAGAGCATTTCGCGGGCCTCCCAAAACCGCATCCCGTCCTCGAT
GTGGTGGATGCGCTGGTTCAGCTCATCATCAAGACGTCGCAGAACTCGGAGGAGTTTGCCATTTACGCGGCGGAG
CAGATCAGCAATCTCGTCTTCCAGCAGGTGGACGACAACTTGGCGCTGGAAAGCCTGGTGCACGTGCTCGAGACG
CTGAGAAAGATATCGGGTCCGGCGCTCAACAACCGCGTCCGGGCCATATTCAGCCAGCAGCCGGGCTCGACGTTC
CTCAGCATCCCCCTGTTGGAGACGCTCTTCCGGACAGATCTCATCGAATGGCGAAACCTCGACCTGGCCATGTCC
CAGGTGGTGGAGAGCCGCAAGGAGGGGTCGCTCGAGTTCCTGGAGCACATGCTGGACCTCGCCTTGCTCAATGAA
CGTCCGATGGCGCTGTACGCGGACTTTGCCCGCACCCTGGAGATGGCCTGGGCTTGGATCTGCGAAGACGGCGGC
TCGGCGGCGGGTCAGCGGCTCAAGAGTAAACTGATGGGCTCTCCCGCTCTGCCCCTGGCGTCACGGAGCCCGGAC
GGAGATGAGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCTCGGCAGGATCAGCTG
GAATACGTCTTCGAGGAGTGGGTGCACCTCTGCAACAACCCGAACGCATCGGCCAAGGCCACCATCTTTTTCCTG
CAGCAGTTGCAGGCGAAGCAGATGATCCGCGGCAGAGACGACTTGTTCGTCTTCATCCGAGTCGCCCTCGACCTG
GCGGTGGACCGGTTCGAACACGTCCCGCCGCAGTCGAGATCCGGCGTCGAGTCCAAGTACTCGATGACAGACGCC
CTGGCCAAGCTCATGACCATGTTCTTGACAATGCACAGCGAGGGCCCCACGGCGCGCACGGGGTTGCTCGACTCG
ATGCTGGTGCTGGTCGGTCTGGTGCTCAGCCACCACCATGCGAAGCGGGCGGACCACCTGAACCAGCGCGTCTTC
TTCCGTCTCTTGTCGATGATGCTATACGATGTGCAGAACATGTCGGACGAGGTCTCGGAAGAGGAGCAGCGGCAG
ATGATTGTCAAGTTTGCCAAGAGGTTCCAGTTCATGGGGCCGCTGCGGCTCCCCGGCTTCGCCTTTAGCTGGCTC
GGCCTCGTCCAGCACAGGGCATTCCTGCCGGTGCTGATGCAGATTCCGGGGGGCGGCGGGTGGGAGCCGTGCCTG
AAGCTGGTGGTGCAGCTCCTCAGCTGCCTGGGCGAGCAGCTGAAGACGCTGAACGTGTCGCCCGTTACCAAGGAG
CTCTATCGTGGGACGCTCAAGTTCCTCATCGTCCTGCAGCACGACTTTCCGGACTTCCTGGCGGCGAGCCACATG
AAGCTGGCGGCGAGCATCCCGGCCCACTGCACGCAGCTGCTGAATACGGTGCTGGCGGCCAACCCGCAGCAGCAC
TTTGGCAAGCTGCCGGACCCGCTGCACGCAGGGCTCAAGGTGGACCGGATGGAGGACATGAAGACGCACCCCGGG
CTCGTGGAAGAGGCCGTGTCGACGCTGCGAGAATGCGGGCTGCTCAGCGTTCTCGACCAGGTGCTGCAGAGCGGG
CCGACGGAGGACGCGGTGGCGCAGATGGCGCACGCCATGACGCACCGGGTGCCGGAGCAGACGGCATTTGGCCAT
GTGGCGGTGGCGGCCAACGTCGAGGTGATTGGGGCCGTCGTCATCTACACGGGTCAGCACGCGGCCGGACGGGCG
ACGACGGCGTCGACGGCCATTTCGGTGGGCAGCGGCGACCCGGACGTGTCTGTCCTGTCGCTGCTGGTGCACGAG
CTGCCTCCCGAGGCGCGGTACTACCTGCTGTCGAGCATGGCCAACCAGCTACGGTTCCCGTGCGCCCACACCGAG
TACTTCAGCCAGCTCATCCTGTACATGTTTGGAAAGGACCTCAACGATCCGGAGGAGTCGGAGATTCGGCAGGAG
ATTACGCGCGTGCTCCTCGAGCGACTGGTCGGGTTCTGGCCTCAGCCCTGGGGGCTCATGTTTACGATTCTCGAG
CTGGTCAAGAACGACAAGTACATGTTCTTTGAGCTACCATTTGTCAAGTCGACACCAGAGGTTGCCGATAGGTTT
GCTGCCGTCTTGCAACGACCTTAG
Transcript >Ophcf2|01169
ATGGTCCCTCCACCACGAGCGGGATCCTTTTCGCCAAATCCTGCACAGACTCTCCAGACGGGCACCGGGCACTCG
CCGCATCCCTCCCACGCTGGCGTCCTGAGTGCTGGCGCCAGCCCCAGCACCAGCAGCCCGACTGGGACCAACTCT
CTGACCAAGATCGTCGTGGCCCAGGTCTATCTTCTTCTCAGCACCATCAAGGAGGACAAGGACCGTGCCAAGTGG
GAAATCCAGGTGGATCAGTTACGAAAGCTCATCGATGAACACGGCATGGAAGTCTTTTCCAAGTATTTTACCCGT
CTGGTAGCGGGGAATGCGCCCCAGATATTCCCCGGCCTCAACAGGCCGGTTGCGAACCCGGGAAACTACCACATT
CTCGCCGCCGAGATGCGCAAAATCGCCCATGACACCGGTCAAGCTGGCAAGATAGCCGAGTCGGTCGAGAGCGGC
ACTGAGGACATCTTCCGTGACTTCGACCTCTCTACCTTTATGGAGCATTTCAAGCTCGATGCGCTCGAGAAGACT
CTACTGGCCCTGGCGTTCAAAACGGGCTCACGGCCCGACCTCAAGACGAAAGCCGATGCCATCCTGTCGACGAAT
TTTTCGTCCTTCATGGACATCATGTCGCGCCCCGATATCGAGGCGCATGCGGATCTCACGCCGGCCTCTGTAGCC
TTCATCGTCGATCGATTCCTCCAATACCACCCTCCTAGCTTTAATGCTTCGTCCAGACGGGACCTTCATACTTAC
GTCGTCAAGCGGTACGTCAGTATGGATCAACCGCCCCCTTCCCAGGTCCTCGCCGCCCTCGATATAGGCAGGGTC
CTTGCCGATAGGCCGGCAAACGTCTTGGCTCGATATATCCAGAGGACCGGCGCCGACTTCACCCGCGATGAGGAG
ACGTGCTTCTCCTACTTGCAGAGTCGCCCAAGCAGCATGCAGCTCAGCCCTGATCAGGTCTCCGCGGCGCTCATC
TTCACGGCAATCACTCAGAGCCCCCCCCACGACCCGTCGGTGCTCACTGCGGCCCTCCAGCGCGTGCTCCCCAAG
TCGTTTGAGTGGAACGAGGTCATCATGTTCTTCGACCAGCCATCGGCACGCATCTCGTCGTCGCAGTTCCTGCGC
CTCTACAAGGCCTTGCTGCCCATCGCTCAGGACACCAAGCGTAACTTGGACATTCAGCGGCTCTGGGGAGGCTCG
TGGAGCGAGCCCGAGGCCCAGCTGTCCTTTGTCAGTGCTTACGGTTCCTTGACGCCTGACCAGCTCGATGCGACG
ACGATCCCCCGCCTGCACCGAAGCATCAACATCGAAGACTACGCCAACGCTTCGCCCGGCCTGCAGGAGCGAGCC
GCGGTGGCCGTCAAGCATCCGCTGGTCTCCGTCGCCGCCCTCTCCGCCATCTTCAACGTTGCCCTCAACTCGGTT
CATGCCTCGCAAAGTGTCGAGGCTAAGCGTCTGTTTCAGGAGGTGGTGGTGCCGAACCTCGACATCTTTCTCGTG
TCTGCCTTTGAGGTTCCGCGACAGTCGTGGGCGACAATGGCCGTCGACACGCTCAACTCGCTCTTCGAGAACTTC
TTCTACAAGCGATCACCGGAATACGAATTCGTGCTCGATAGCCTGTGGAAGAAGGATCGTGAATGGGTCGTCCAG
CGCCTCATCGACGCCCACGCCGTGAAGCCCATCGACTTGCCTTTGGTCTACGAGCACGCCGTGAAACTGGGCTGG
CTCGATGACTTGGTCTATCTCCCCAATGGTTTCGGCATCGACCTCGCCGCATATGCACACTCCCAGGGCCATCTG
GACCTGGCTAACTGGGCGCGGTTCAACGCCGACAGGAGCGCCGAGATTGCGCGTACCTTGCTGCAGTTTCTGATG
ATCAAGGCCAACCTAGAGATTCAGTTTCAGCGACCGCCCGATGGTCAGCCCGCGGTGAAGACGAGCACTAGCTTG
CAGGTCCGGACCGTCTCTGCCCTGCTGCAGATACTCGAAGACTTCCTTCCGGGTGCTCCGGTTCAGGACCTCATT
CTTGTACAACGTCACTGTATCACCGCGTACCCGCGACTCATCAACTACGGCGAAGGCTACGACGACGTCATCGAC
GCGAATGGCAGGGATGGGAACGCCTTGCCGCAAGCCGCTAACAGCAAGATGGAGGAGCACTACAAGAAGATGTAC
GGCGACGAACTGCAGGTCCGCACGATTGTAGAGATATTGGACCGCTACAAGCGTTCGCGGGAGCCTCTTGACCAG
GACGCTTTTGCCTGCATGATTCATGGCCTCTTCGACGAGTATAACCACTACGTGGACTACCCATTGGAGGCTCTC
GCCACGACTGCGGTCCTGTTCGGCGGCATTATCTCTCACAAGCTGATTGCAGAACTCCCCCTGCAGATCGGCCTG
GGCATGATCCTCGAAGCGGTCAGGGATCACATGCCCGACGACCCCATGCACAAGTTCGGTCTACAGGCCCTGATG
CAGCTCCTGGTCCGGTTCAGGGAGTGGCCCGGCTTCTGCGAGCAACTGCTGCAGATCCCCGGCTTGCGTGGCACG
GAGGCCTACAAAAAGGCCGAGGAGATTGTCAGGGATCATGAGAAGGAGGTGGCGCGTTCGCGCAACGGCGCCGGC
ACGCCGCGTGGCCTGAATTTCGCGGGCGACTCTTTCGTTAACGGCAATACGGACGAGCCCGTGGCCAGCGATCGC
CAAGCTCCTCCGTTCGCGGCCATTGGGGTCGAGGCCGTACCCGTCGGCGCCGATTTCGAGGAGCCCGGCGACGAG
GAGCAGGGCAAGATACAGTTCGTTCTGAACAACATCACTGAGGGCACTCTGCAGTCGATGCGCAACGAGCTGCGT
GAGATGCTGGAACGCAAGCACCAGCAGTGGTTTGCCGGCCATCTCGTCGAGGAGCGCGCCAAGATGCAACCCAAC
TACCACCACGTCTACCTGGAGCTCGTGAAGCTCTTCGAGGACAACGTCTTATGGAGCGAAGTCCTCCGCGAGACG
TTCATCAGCGTGGCCCGGATGCTCAACTCGGAACTGACGATGCAGAATTCGACGGAGAGAACCCATCTTAAAAAC
CTTGGGGGCTGGCTTGGCCTCCTGACTCTGGCCCGAGACAAGCCGATCAAACACAAGAACATCGCCTTCAAGCAG
CTCCTGATGGAGGCGCACGACACCAAGAGGCTGATTGTTGTCATACCCTTCGTCTGCAAGGTGCTGATCCAAGGC
GCCACGTCGCAAGTTTTTCGGCCCCCGAACCCGTGGCTGATGGACATTATTCATCTCCTGATCGAGCTGTACCAT
CACGCCGAACTCAAGTTGAACCTCAAATTCGAGATTGAGGTTCTCTGCAAGGGGTTGAATCTCGACCACAAGAGT
ATCGAACCGTCGGGCGAGATTTTGAACCGGCCGTCGGCTGAGGATGTCGTCGAAAGCCTACCGCAAGGCCAGATG
GACGCTTTCGAAAACCTGTCGCTGAACGGAATCGGGTCCGTAGTCGGCTCGGGTCTCTCTCCGCAGGCCGTCGCA
CCCACCATCCCGGACGTCGGCCCCCTGATCACCATCCCGCCGACAAACGAGATGGTGGTCAGCACGTCGCGCCTG
CACGAGATTGTGGCGGCGGCCCTGACGAACGCCTTGCAAGATATCATCCAGCCCGTCGTGGACAGGTCCATAACG
ATAGCAGCGATATCCACCGTGCAGATGATACGCAAGGACTTCGTTTCGGAGCCCGACGAGAACCGGCTCCGAACG
TCGGCCGTCAATATGGTTAAGGCGACAGCGGGCAGCCTGGCCCTCGTGACGTCAAAGGAGCCTCTACGCGCAAAT
ATGACGAATTACATGCGGAATCTGGCCAACGACCTGCCTTCGGGCCTTCCTGAGGGGACCATCATAATGTGTGTC
AACTCGAACCTAGATTTGGCATGCAGCATCATCGAAAAGCAAGCCGAGGAGCGGGCAGTGCCGGAAATCGAAGAC
CTGCTGGAGGAAGACATGGCAGCACGGAGGCGACACCGCATCCAACAGCCAAACGAGCCCTTTTACTCGGGCAAC
GTCAATCGTTGGGGCATGACGATTCCGAATCCGTACAAGCTGTCGCCCAACGTCAACGGTCTCAACCCAGAGCAG
ATGGCCATTTACGAGGACTTCGCTAGACAGCCGCGAAACGCCACGGCCTCGGGGCCCTCACACGCTCCCTCGACG
TCCGACGCCACCCGCTCCCTGGCGAACGAGGTGCTGCAGGAGTCGTACAATGCTGTGCCGTCCCTTCCCGCTCCG
AGCGAGACGTCGTCGATGCCGCACATGGGACCGCAGCTGCAGCCTTACGGCCCGATCCACGCGGCCGCCAACAAC
CTGGCAGGCGGGCGGGCGACCAGCTTCCAGATGGACGTGCGAGGCCTGGCTGATCGCGTCAATAAGCTTCTTCAA
GAGCTGATGCGTGTTTCGGGAGAGGCTCGGGAAGAGCATTTCGCGGGCCTCCCAAAACCGCATCCCGTCCTCGAT
GTGGTGGATGCGCTGGTTCAGCTCATCATCAAGACGTCGCAGAACTCGGAGGAGTTTGCCATTTACGCGGCGGAG
CAGATCAGCAATCTCGTCTTCCAGCAGGTGGACGACAACTTGGCGCTGGAAAGCCTGGTGCACGTGCTCGAGACG
CTGAGAAAGATATCGGGTCCGGCGCTCAACAACCGCGTCCGGGCCATATTCAGCCAGCAGCCGGGCTCGACGTTC
CTCAGCATCCCCCTGTTGGAGACGCTCTTCCGGACAGATCTCATCGAATGGCGAAACCTCGACCTGGCCATGTCC
CAGGTGGTGGAGAGCCGCAAGGAGGGGTCGCTCGAGTTCCTGGAGCACATGCTGGACCTCGCCTTGCTCAATGAA
CGTCCGATGGCGCTGTACGCGGACTTTGCCCGCACCCTGGAGATGGCCTGGGCTTGGATCTGCGAAGACGGCGGC
TCGGCGGCGGGTCAGCGGCTCAAGAGTAAACTGATGGGCTCTCCCGCTCTGCCCCTGGCGTCACGGAGCCCGGAC
GGAGATGAGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCTCGGCAGGATCAGCTG
GAATACGTCTTCGAGGAGTGGGTGCACCTCTGCAACAACCCGAACGCATCGGCCAAGGCCACCATCTTTTTCCTG
CAGCAGTTGCAGGCGAAGCAGATGATCCGCGGCAGAGACGACTTGTTCGTCTTCATCCGAGTCGCCCTCGACCTG
GCGGTGGACCGGTTCGAACACGTCCCGCCGCAGTCGAGATCCGGCGTCGAGTCCAAGTACTCGATGACAGACGCC
CTGGCCAAGCTCATGACCATGTTCTTGACAATGCACAGCGAGGGCCCCACGGCGCGCACGGGGTTGCTCGACTCG
ATGCTGGTGCTGGTCGGTCTGGTGCTCAGCCACCACCATGCGAAGCGGGCGGACCACCTGAACCAGCGCGTCTTC
TTCCGTCTCTTGTCGATGATGCTATACGATGTGCAGAACATGTCGGACGAGGTCTCGGAAGAGGAGCAGCGGCAG
ATGATTGTCAAGTTTGCCAAGAGGTTCCAGTTCATGGGGCCGCTGCGGCTCCCCGGCTTCGCCTTTAGCTGGCTC
GGCCTCGTCCAGCACAGGGCATTCCTGCCGGTGCTGATGCAGATTCCGGGGGGCGGCGGGTGGGAGCCGTGCCTG
AAGCTGGTGGTGCAGCTCCTCAGCTGCCTGGGCGAGCAGCTGAAGACGCTGAACGTGTCGCCCGTTACCAAGGAG
CTCTATCGTGGGACGCTCAAGTTCCTCATCGTCCTGCAGCACGACTTTCCGGACTTCCTGGCGGCGAGCCACATG
AAGCTGGCGGCGAGCATCCCGGCCCACTGCACGCAGCTGCTGAATACGGTGCTGGCGGCCAACCCGCAGCAGCAC
TTTGGCAAGCTGCCGGACCCGCTGCACGCAGGGCTCAAGGTGGACCGGATGGAGGACATGAAGACGCACCCCGGG
CTCGTGGAAGAGGCCGTGTCGACGCTGCGAGAATGCGGGCTGCTCAGCGTTCTCGACCAGGTGCTGCAGAGCGGG
CCGACGGAGGACGCGGTGGCGCAGATGGCGCACGCCATGACGCACCGGGTGCCGGAGCAGACGGCATTTGGCCAT
GTGGCGGTGGCGGCCAACGTCGAGGTGATTGGGGCCGTCGTCATCTACACGGGTCAGCACGCGGCCGGACGGGCG
ACGACGGCGTCGACGGCCATTTCGGTGGGCAGCGGCGACCCGGACGTGTCTGTCCTGTCGCTGCTGGTGCACGAG
CTGCCTCCCGAGGCGCGGTACTACCTGCTGTCGAGCATGGCCAACCAGCTACGGTTCCCGTGCGCCCACACCGAG
TACTTCAGCCAGCTCATCCTGTACATGTTTGGAAAGGACCTCAACGATCCGGAGGAGTCGGAGATTCGGCAGGAG
ATTACGCGCGTGCTCCTCGAGCGACTGGTCGGGTTCTGGCCTCAGCCCTGGGGGCTCATGTTTACGATTCTCGAG
CTGGTCAAGAACGACAAGTACATGTTCTTTGAGCTACCATTTGTCAAGTCGACACCAGAGGTTGCCGATAGGTTT
GCTGCCGTCTTGCAACGACCTTAG
Gene >Ophcf2|01169
ATGGTCCCTCCACCACGAGCGGGATCCTTTTCGCCAAATCCTGCACAGACTCTCCAGACGGGCACCGGGCACTCG
CCGCATCCCTCCCACGCTGGCGTCCTGAGTGCTGGCGCCAGCCCCAGCACCAGCAGCCCGACTGGGACCAACTCT
CTGACCAAGATCGTCGTGGCCCAGGTCTATCTTCTTCTCAGCACCATCAAGGAGGACAAGGACCGTGCCAAGTGG
GAAATCCAGGTGGATCAGTTACGAAAGGTGAGTCCCGCTCCGGTCCCCTCGTCCAGTGCCACGGCTAACCGCCAA
CCTCGTTCAAGCTCATCGATGAACACGGCATGGAAGTCTTTTCCAAGTATTTTACCCGTCTGGTAGCGGGGAATG
CGCCCCAGATATTCCCCGGCCTCAACAGGCCGGTTGCGAACCCGGGAAACTACCACATTCTCGCCGCCGAGATGC
GCAAAATCGCCCATGACACCGGTCAAGCTGGCAAGATAGCCGAGTCGGTCGAGAGCGGCACTGAGGACATCTTCC
GTGACTTCGACCTCTCTACCTTTATGGAGCATTTCAAGCTCGATGCGCTCGAGAAGACTCTACTGGCCCTGGCGT
TCAAAACGGGCTCACGGCCCGACCTCAAGACGAAAGGTAATTATTTGGTGCCGTCCATGCCGCAACGAGAGAGCC
TGGCAAGCTGACATGTCATCTGCAGCCGATGCCATCCTGTCGACGAATTTTTCGTCCTTCATGGACATCATGTCG
CGCCCCGATATCGAGGCGCATGCGGATCTCACGCCGGCCTCTGTAGCCTTCATCGTCGATCGATTCCTCCAATAC
CACCCTCCTAGCTTTAATGCTTCGTCCAGACGGGACCTTCATACTTACGTCGTCAAGCGGTACGTCAGTATGGAT
CAACCGCCCCCTTCCCAGGTCCTCGCCGCCCTCGATATAGGCAGGGTCCTTGCCGATAGGCCGGCAAACGTCTTG
GCTCGATATATCCAGAGGACCGGCGCCGACTTCACCCGCGATGAGGAGACGTGCTTCTCCTACTTGCAGAGTCGC
CCAAGCAGCATGCAGCTCAGCCCTGATCAGGTCTCCGCGGCGCTCATCTTCACGGCAATCACTCAGAGCCCCCCC
CACGACCCGTCGGTGCTCACTGCGGCCCTCCAGCGCGTGCTCCCCAAGTCGTTTGAGTGGAACGAGGTCATCATG
TTCTTCGACCAGCCATCGGCACGCATCTCGTCGTCGCAGTTCCTGCGCCTCTACAAGGCCTTGCTGCCCATCGCT
CAGGACACCAAGCGTAACTTGGACATTCAGCGGCTCTGGGGAGGCTCGTGGAGCGAGCCCGAGGCCCAGCTGTCC
TTTGTCAGTGCTTACGGTTCCTTGACGCCTGACCAGCTCGATGCGACGACGATCCCCCGCCTGCACCGAAGCATC
AACATCGAAGACTACGCCAACGCTTCGCCCGGCCTGCAGGAGCGAGCCGCGGTGGCCGTCAAGCATCCGCTGGTC
TCCGTCGCCGCCCTCTCCGCCATCTTCAACGTTGCCCTCAACTCGGTTCATGCCTCGCAAAGTGTCGAGGCTAAG
CGTCTGTTTCAGGAGGTGGTGGTGCCGAACCTCGACATCTTTCTCGTGTCTGCCTTTGAGGTTCCGCGACAGTCG
TGGGCGACAATGGCCGTCGACACGCTCAACTCGCTCTTCGAGAACTTCTTCTACAAGCGATCACCGGAATACGAA
TTCGTGCTCGATAGCCTGTGGAAGAAGGATCGTGAATGGGTCGTCCAGCGCCTCATCGACGCCCACGCCGTGAAG
CCCATCGACTTGCCTTTGGTCTACGAGCACGCCGTGAAACTGGGCTGGCTCGATGACTTGGTCTATCTCCCCAAT
GGTTTCGGCATCGACCTCGCCGCATATGCACACTCCCAGGGCCATCTGGACCTGGCTAACTGGGCGCGGTTCAAC
GCCGACAGGAGCGCCGAGATTGCGCGTACCTTGCTGCAGTTTCTGATGATCAAGGCCAACCTAGAGATTCAGTTT
CAGCGACCGCCCGATGGTCAGCCCGCGGTGAAGACGAGCACTAGCTTGCAGGTCCGGACCGTCTCTGCCCTGCTG
CAGATACTCGAAGACTTCCTTCCGGGTGCTCCGGTTCAGGACCTCATTCTTGTACAACGTCACTGTATCACCGCG
TACCCGCGACTCATCAACTACGGCGAAGGCTACGACGACGTCATCGACGCGAATGGCAGGGATGGGAACGCCTTG
CCGCAAGCCGCTAACAGCAAGATGGAGGAGCACTACAAGAAGATGTACGGCGACGAACTGCAGGTCCGCACGATT
GTAGAGATATTGGACCGCTACAAGCGTTCGCGGGAGCCTCTTGACCAGGACGCTTTTGCCTGCATGATTCATGGC
CTCTTCGACGAGTATAACCACTACGTGGACTACCCATTGGAGGCTCTCGCCACGACTGCGGTCCTGTTCGGCGGC
ATTATCTCTCACAAGCTGATTGCAGAACTCCCCCTGCAGATCGGCCTGGGCATGATCCTCGAAGCGGTCAGGGAT
CACATGCCCGACGACCCCATGCACAAGTTCGGTCTACAGGCCCTGATGCAGCTCCTGGTCCGGTTCAGGGAGTGG
CCCGGCTTCTGCGAGCAACTGCTGCAGATCCCCGGCTTGCGTGGCACGGAGGCCTACAAAAAGGCCGAGGAGATT
GTCAGGGATCATGAGAAGGAGGTGGCGCGTTCGCGCAACGGCGCCGGCACGCCGCGTGGCCTGAATTTCGCGGGC
GACTCTTTCGTTAACGGCAATACGGACGAGCCCGTGGCCAGCGATCGCCAAGCTCCTCCGTTCGCGGCCATTGGG
GTCGAGGCCGTACCCGTCGGCGCCGATTTCGAGGAGCCCGGCGACGAGGAGCAGGGCAAGATACAGTTCGTTCTG
AACAACATCACTGAGGGCACTCTGCAGTCGATGCGCAACGAGCTGCGTGAGATGCTGGAACGCAAGCACCAGCAG
TGGTTTGCCGGCCATCTCGTCGAGGAGCGCGCCAAGATGCAACCCAACTACCACCACGTCTACCTGGAGCTCGTG
AAGCTCTTCGAGGACAACGTCTTATGGAGCGAAGTCCTCCGCGAGACGTTCATCAGCGTGGCCCGGATGCTCAAC
TCGGAACTGACGATGCAGAATTCGACGGAGAGAACCCATCTTAAAAACCTTGGGGGCTGGCTTGGCCTCCTGACT
CTGGCCCGAGACAAGCCGATCAAACACAAGAACATCGCCTTCAAGCAGCTCCTGATGGAGGCGCACGACACCAAG
AGGCTGATTGTTGTCATACCCTTCGTCTGCAAGGTGCTGATCCAAGGCGCCACGTCGCAAGTTTTTCGGCCCCCG
AACCCGTGGCTGATGGACATTATTCATCTCCTGATCGAGCTGTACCATCACGCCGAACTCAAGTTGAACCTCAAA
TTCGAGATTGAGGTTCTCTGCAAGGGGTTGAATCTCGACCACAAGAGTATCGAACCGTCGGGCGAGATTTTGAAC
CGGCCGTCGGCTGAGGATGTCGTCGAAAGCCTACCGCAAGGCCAGATGGACGCTTTCGAAAACCTGTCGCTGAAC
GGAATCGGGTCCGTAGTCGGCTCGGGTCTCTCTCCGCAGGCCGTCGCACCCACCATCCCGGACGTCGGCCCCCTG
ATCACCATCCCGCCGACAAACGAGATGGTGGTCAGCACGTCGCGCCTGCACGAGATTGTGGCGGCGGCCCTGACG
AACGCCTTGCAAGATATCATCCAGCCCGTCGTGGACAGGTCCATAACGATAGCAGCGATATCCACCGTGCAGATG
ATACGCAAGGACTTCGTTTCGGAGCCCGACGAGAACCGGCTCCGAACGTCGGCCGTCAATATGGTTAAGGCGACA
GCGGGCAGCCTGGCCCTCGTGACGTCAAAGGAGCCTCTACGCGCAAATATGACGAATTACATGCGGAATCTGGCC
AACGACCTGCCTTCGGGCCTTCCTGAGGGGACCATCATAATGTGTGTCAACTCGAACCTAGATTTGGCATGCAGC
ATCATCGAAAAGCAAGCCGAGGAGCGGGCAGTGCCGGAAATCGAAGACCTGCTGGAGGAAGACATGGCAGCACGG
AGGCGACACCGCATCCAACAGCCAAACGAGCCCTTTTACTCGGGCAACGTCAATCGTTGGGGCATGACGATTCCG
AATCCGTACAAGCTGTCGCCCAACGTCAACGGTCTCAACCCAGAGCAGATGGCCATTTACGAGGACTTCGCTAGA
CAGCCGCGAAACGCCACGGCCTCGGGGCCCTCACACGCTCCCTCGACGTCCGACGCCACCCGCTCCCTGGCGAAC
GAGGTGCTGCAGGAGTCGTACAATGCTGTGCCGTCCCTTCCCGCTCCGAGCGAGACGTCGTCGATGCCGCACATG
GGACCGCAGCTGCAGCCTTACGGCCCGATCCACGCGGCCGCCAACAACCTGGCAGGCGGGCGGGCGACCAGCTTC
CAGATGGACGTGCGAGGCCTGGCTGATCGCGTCAATAAGCTTCTTCAAGAGCTGATGCGTGTTTCGGGAGAGGCT
CGGGAAGAGCATTTCGCGGGCCTCCCAAAACCGCATCCCGTCCTCGATGTGGTGGATGCGCTGGTTCAGCTCATC
ATCAAGACGTCGCAGAACTCGGAGGAGTTTGCCATTTACGCGGCGGAGCAGATCAGCAATCTCGTCTTCCAGCAG
GTGGACGACAACTTGGCGCTGGAAAGCCTGGTGCACGTGCTCGAGACGCTGAGAAAGATATCGGGTCCGGCGCTC
AACAACCGCGTCCGGGCCATATTCAGCCAGCAGCCGGGCTCGACGTTCCTCAGCATCCCCCTGTTGGAGACGCTC
TTCCGGACAGATCTCATCGAATGGCGAAACCTCGACCTGGCCATGTCCCAGGTGGTGGAGAGCCGCAAGGAGGGG
TCGCTCGAGTTCCTGGAGCACATGCTGGACCTCGCCTTGCTCAATGAACGTCCGATGGCGCTGTACGCGGACTTT
GCCCGCACCCTGGAGATGGCCTGGGCTTGGATCTGCGAAGACGGCGGCTCGGCGGCGGGTCAGCGGCTCAAGAGT
AAACTGATGGGCTCTCCCGCTCTGCCCCTGGCGTCACGGAGCCCGGACGGAGATGAGGCGGCGGCGGCGGCGGCG
GCGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCTCGGCAGGATCAGCTGGAATACGTCTTCGAGGAGTGGGTGCAC
CTCTGCAACAACCCGAACGCATCGGCCAAGGCCACCATCTTTTTCCTGCAGCAGTTGCAGGCGAAGCAGATGATC
CGCGGCAGAGACGACTTGTTCGTCTTCATCCGAGTCGCCCTCGACCTGGCGGTGGACCGGTTCGAACACGTCCCG
CCGCAGTCGAGATCCGGCGTCGAGTCCAAGTACTCGATGACAGACGCCCTGGCCAAGCTCATGACCATGTTCTTG
ACAATGCACAGCGAGGGCCCCACGGCGCGCACGGGGTTGCTCGACTCGATGCTGGTGCTGGTCGGTCTGGTGCTC
AGCCACCACCATGCGAAGCGGGCGGACCACCTGAACCAGCGCGTCTTCTTCCGTCTCTTGTCGATGATGCTATAC
GATGTGCAGAACATGTCGGACGAGGTCTCGGAAGAGGAGCAGCGGCAGATGATTGTCAAGTTTGCCAAGAGGTTC
CAGTTCATGGGGCCGCTGCGGCTCCCCGGCTTCGCCTTTAGCTGGCTCGGCCTCGTCCAGCACAGGGCATTCCTG
CCGGTGCTGATGCAGATTCCGGGGGGCGGCGGGTGGGAGCCGTGCCTGAAGCTGGTGGTGCAGCTCCTCAGCTGC
CTGGGCGAGCAGCTGAAGACGCTGAACGTGTCGCCCGTTACCAAGGAGCTCTATCGTGGGACGCTCAAGTTCCTC
ATCGTCCTGCAGCACGACTTTCCGGACTTCCTGGCGGCGAGCCACATGAAGCTGGCGGCGAGCATCCCGGCCCAC
TGCACGCAGCTGCTGAATACGGTGCTGGCGGCCAACCCGCAGCAGCACTTTGGCAAGCTGCCGGACCCGCTGCAC
GCAGGGCTCAAGGTGGACCGGATGGAGGACATGAAGACGCACCCCGGGCTCGTGGAAGAGGCCGTGTCGACGCTG
CGAGAATGCGGGCTGCTCAGCGTTCTCGACCAGGTGCTGCAGAGCGGGCCGACGGAGGACGCGGTGGCGCAGATG
GCGCACGCCATGACGCACCGGGTGCCGGAGCAGACGGCATTTGGCCATGTGGCGGTGGCGGCCAACGTCGAGGTG
ATTGGGGCCGTCGTCATCTACACGGGTCAGCACGCGGCCGGACGGGCGACGACGGCGTCGACGGCCATTTCGGTG
GGCAGCGGCGACCCGGACGTGTCTGTCCTGTCGCTGCTGGTGCACGAGCTGCCTCCCGAGGCGCGGTACTACCTG
CTGTCGAGCATGGCCAACCAGCTACGGTTCCCGTGCGCCCACACCGAGTACTTCAGCCAGCTCATCCTGTACATG
TTTGGAAAGGACCTCAACGATCCGGAGGAGTCGGAGATTCGGCAGGAGATTACGCGCGTGCTCCTCGAGCGACTG
GTCGGGTTCTGGCCTCAGCCCTGGGGGCTCATGTTTACGATTCTCGAGCTGGTCAAGAACGACAAGTACATGTTC
TTTGAGCTACCATTTGTCAAGTCGACACCAGAGGTGAGAGCCAAGGCTTTCGATGGCCCACGCCGTCGATGATGG
TGACTTACCAGATGAGCAGGTTGCCGATAGGTTTGCTGCCGTCTTGCAACGACCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail