Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01168
Gene name
Locationscaffold_01:4248396..4251380
Strand-
Gene length (bp)2984
Transcript length (bp)2682
Coding sequence length (bp)2682
Protein length (aa) 894

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00611 FCH Fes/CIP4, and EFC/F-BAR homology domain 2.4E-15 26 97
PF07653 SH3_2 Variant SH3 domain 1.0E-11 837 893
PF00018 SH3_1 SH3 domain 1.6E-12 839 887
PF14604 SH3_9 Variant SH3 domain 1.8E-10 840 890

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7937 0.2754 0.093 0.4856 0.0833 0.0041 0.1215 0.2275 0.1142 0.0191

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3128
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5462
Ophiocordyceps australis map64 (Brazil) OphauB2|7052
Ophiocordyceps camponoti-floridani Ophcf2|01168 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2205
Ophiocordyceps kimflemingae Ophio5|4646
Ophiocordyceps subramaniannii Hirsu2|5491

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01168
MPAVTADAPAVALSFANNFWGKDDAGVNPLLERMQGAKQTCDELRAFYGARATIEDDYARKLLNLCRKSLGTYEM
GTLKTSLDTVRGELESMAKQHQSIAAQMKTELEEPLAAFAGGMKERRKIVQNSVEKLLKTKMQQTQQVNKTRDKY
EQECLKIKGYLAQGHMVMGQEERRNKAKLEKTQISLATANTEYEYAVKALEETTARWNREWKAAADKFQDLEEER
LDFTKSSLWTFANIASTVCVSDDASCEKIRLSLETMEVERDIVHFISERGTGQEIPDPPKYINFCRGDVTDSQSE
ASEDDNYSVAQFPRSINPAFRSSSPQPSTFESHHDPNSALANNLAHREPMPSTSREATLTPQKTPKASRMPAHNQ
HPVQSPSRHEPYDIDAHERLATVPHDPYPMDGMTMLCRTAPSSDRGSQPTSARPSSRDSQADYSGSMSSCSQDLT
SGKTSPARQDQTPVSSPEKRVFKKKSGFFQNHSPFRRKSTKEMSVPIQAGRSSTWQTSSTHKKDPIERAVSPEPI
DANASIALGVGQNVLPVTATEANRQTGRTAAPELDANDPIAVALAELKDNGGKQSSLRVSADHYHGIATPAPGTE
SRTTRPVPVPGSHDAAMASRGTPPPSYQQPAQVTRLGVPPPAVTSKAMKEATKKVTAQTRTIFGNDVRAGGGTQR
TSPGFRPPTRGTDIPRAKSPAPARSVSPQPRANNDVRGGGGYRSASPNPQRRHHRAQSQAATPGSRRGGEPSIYG
GASPGRETSSSAHRDYNRPQSSYGASADMAVQLAPAEDDGYGSQRSRGSESSRAMGLYDGGGTRSRSKSVADPAR
QYSRDGRPILHYARALYMYQAAIPEELGFTKGDFLAVFRHQDDGWWEAEIHGGNGRVGLVPSNYLVPC*
Coding >Ophcf2|01168
ATGCCCGCGGTGACGGCCGATGCTCCGGCGGTCGCGCTGTCCTTCGCCAATAACTTTTGGGGCAAGGACGATGCT
GGAGTCAACCCGCTCCTGGAGCGTATGCAGGGTGCCAAACAAACATGCGATGAACTGAGAGCCTTTTACGGCGCC
CGCGCTACCATCGAAGATGATTACGCCAGAAAGCTTCTCAACCTGTGTCGAAAGTCTCTCGGAACCTACGAAATG
GGGACGCTCAAGACTTCCCTCGATACCGTACGCGGAGAACTCGAGTCCATGGCCAAGCAGCACCAAAGTATCGCC
GCCCAGATGAAGACAGAACTCGAAGAGCCGCTGGCCGCCTTCGCAGGGGGGATGAAGGAACGACGCAAGATTGTC
CAGAACTCGGTCGAGAAGCTGTTGAAAACCAAGATGCAGCAGACGCAACAAGTAAACAAGACGCGAGACAAGTAC
GAGCAGGAGTGCCTCAAGATCAAGGGATACCTCGCCCAGGGCCACATGGTCATGGGCCAGGAGGAGCGCCGGAAC
AAGGCGAAGCTGGAGAAGACACAGATCAGCCTCGCCACGGCCAATACCGAGTACGAATACGCCGTCAAGGCCCTC
GAGGAGACGACGGCGAGGTGGAACAGAGAGTGGAAGGCCGCCGCGGACAAGTTTCAAGACCTCGAGGAGGAGCGC
CTCGACTTCACCAAGAGCAGCCTGTGGACATTTGCCAACATCGCCTCGACTGTCTGCGTCAGCGACGACGCTTCG
TGCGAGAAGATACGCCTATCTCTGGAGACGATGGAGGTGGAAAGGGACATTGTCCACTTCATCAGCGAACGGGGG
ACCGGCCAAGAGATTCCTGATCCGCCAAAGTACATCAACTTTTGTCGTGGAGACGTGACCGACAGCCAGTCGGAG
GCGTCCGAGGACGACAACTACTCGGTGGCTCAGTTCCCTCGCAGCATTAACCCGGCCTTTCGATCATCATCGCCC
CAGCCGTCGACGTTTGAGTCACACCATGATCCCAATTCAGCCTTGGCCAACAACCTGGCTCATAGGGAGCCCATG
CCGTCGACAAGCCGTGAGGCCACGTTGACGCCCCAGAAGACGCCCAAGGCATCGAGGATGCCGGCTCACAACCAA
CATCCCGTACAGTCACCCTCCAGACACGAGCCATACGATATCGATGCACACGAGCGTCTAGCGACTGTCCCGCAC
GACCCATATCCAATGGACGGCATGACGATGCTCTGCCGCACCGCGCCGTCTTCAGACCGAGGCTCTCAGCCGACA
TCCGCCCGGCCGTCGAGCCGCGACTCGCAGGCCGATTACTCGGGCTCTATGTCGTCGTGCAGTCAGGACCTTACC
AGCGGGAAGACGAGTCCGGCAAGGCAAGACCAGACTCCCGTGTCGAGCCCGGAGAAGCGCGTATTCAAGAAGAAG
AGCGGCTTCTTTCAGAACCACAGTCCCTTCAGACGAAAGAGCACCAAGGAAATGTCGGTGCCGATACAGGCGGGA
CGAAGCAGCACGTGGCAGACATCGAGCACCCACAAGAAGGATCCGATAGAACGAGCGGTTAGCCCTGAGCCCATC
GACGCCAACGCCAGTATCGCCCTGGGTGTCGGCCAGAACGTGCTGCCTGTCACGGCAACCGAGGCGAATCGACAG
ACGGGCCGTACGGCAGCGCCCGAGCTTGACGCCAATGACCCCATCGCTGTTGCGCTGGCGGAGCTCAAGGACAAC
GGGGGCAAGCAGTCGTCGTTGAGAGTCTCGGCGGACCACTATCACGGTATCGCCACTCCGGCCCCGGGCACGGAG
AGCCGCACGACGCGGCCGGTGCCGGTGCCCGGGAGCCACGATGCCGCCATGGCCAGCCGCGGGACGCCTCCGCCC
TCGTATCAGCAGCCGGCGCAGGTGACGAGACTGGGAGTTCCACCGCCGGCAGTGACGTCCAAGGCTATGAAGGAG
GCGACGAAGAAGGTGACGGCGCAGACGCGTACCATCTTCGGAAACGACGTGAGAGCTGGCGGCGGGACTCAACGC
ACGTCTCCCGGCTTCCGGCCCCCGACGCGTGGCACCGACATACCCCGGGCGAAGTCGCCGGCTCCGGCCCGGAGC
GTATCGCCGCAGCCGCGGGCCAACAACGACGTGCGCGGCGGCGGCGGCTACCGATCGGCGTCGCCCAATCCCCAA
CGTCGCCACCACAGGGCGCAGTCCCAAGCTGCGACCCCCGGATCCAGACGCGGAGGCGAGCCGTCCATATACGGA
GGCGCATCGCCTGGCCGAGAAACGTCATCGTCGGCGCATCGGGACTACAACCGGCCTCAGAGCAGTTACGGCGCC
TCAGCCGATATGGCAGTGCAGTTGGCGCCGGCAGAAGACGATGGCTACGGGTCCCAACGCAGCCGGGGATCCGAG
TCATCGCGCGCCATGGGGCTCTATGACGGGGGAGGGACTCGTTCGCGAAGCAAGTCTGTGGCAGACCCGGCTCGG
CAGTACTCACGAGACGGACGGCCGATACTGCATTACGCGCGGGCTCTCTACATGTACCAAGCGGCCATACCGGAG
GAGCTGGGCTTCACCAAGGGAGACTTCCTGGCCGTCTTCCGCCACCAAGACGACGGTTGGTGGGAGGCCGAGATT
CACGGTGGCAACGGCCGGGTCGGATTGGTTCCGAGCAACTATCTTGTGCCATGCTAA
Transcript >Ophcf2|01168
ATGCCCGCGGTGACGGCCGATGCTCCGGCGGTCGCGCTGTCCTTCGCCAATAACTTTTGGGGCAAGGACGATGCT
GGAGTCAACCCGCTCCTGGAGCGTATGCAGGGTGCCAAACAAACATGCGATGAACTGAGAGCCTTTTACGGCGCC
CGCGCTACCATCGAAGATGATTACGCCAGAAAGCTTCTCAACCTGTGTCGAAAGTCTCTCGGAACCTACGAAATG
GGGACGCTCAAGACTTCCCTCGATACCGTACGCGGAGAACTCGAGTCCATGGCCAAGCAGCACCAAAGTATCGCC
GCCCAGATGAAGACAGAACTCGAAGAGCCGCTGGCCGCCTTCGCAGGGGGGATGAAGGAACGACGCAAGATTGTC
CAGAACTCGGTCGAGAAGCTGTTGAAAACCAAGATGCAGCAGACGCAACAAGTAAACAAGACGCGAGACAAGTAC
GAGCAGGAGTGCCTCAAGATCAAGGGATACCTCGCCCAGGGCCACATGGTCATGGGCCAGGAGGAGCGCCGGAAC
AAGGCGAAGCTGGAGAAGACACAGATCAGCCTCGCCACGGCCAATACCGAGTACGAATACGCCGTCAAGGCCCTC
GAGGAGACGACGGCGAGGTGGAACAGAGAGTGGAAGGCCGCCGCGGACAAGTTTCAAGACCTCGAGGAGGAGCGC
CTCGACTTCACCAAGAGCAGCCTGTGGACATTTGCCAACATCGCCTCGACTGTCTGCGTCAGCGACGACGCTTCG
TGCGAGAAGATACGCCTATCTCTGGAGACGATGGAGGTGGAAAGGGACATTGTCCACTTCATCAGCGAACGGGGG
ACCGGCCAAGAGATTCCTGATCCGCCAAAGTACATCAACTTTTGTCGTGGAGACGTGACCGACAGCCAGTCGGAG
GCGTCCGAGGACGACAACTACTCGGTGGCTCAGTTCCCTCGCAGCATTAACCCGGCCTTTCGATCATCATCGCCC
CAGCCGTCGACGTTTGAGTCACACCATGATCCCAATTCAGCCTTGGCCAACAACCTGGCTCATAGGGAGCCCATG
CCGTCGACAAGCCGTGAGGCCACGTTGACGCCCCAGAAGACGCCCAAGGCATCGAGGATGCCGGCTCACAACCAA
CATCCCGTACAGTCACCCTCCAGACACGAGCCATACGATATCGATGCACACGAGCGTCTAGCGACTGTCCCGCAC
GACCCATATCCAATGGACGGCATGACGATGCTCTGCCGCACCGCGCCGTCTTCAGACCGAGGCTCTCAGCCGACA
TCCGCCCGGCCGTCGAGCCGCGACTCGCAGGCCGATTACTCGGGCTCTATGTCGTCGTGCAGTCAGGACCTTACC
AGCGGGAAGACGAGTCCGGCAAGGCAAGACCAGACTCCCGTGTCGAGCCCGGAGAAGCGCGTATTCAAGAAGAAG
AGCGGCTTCTTTCAGAACCACAGTCCCTTCAGACGAAAGAGCACCAAGGAAATGTCGGTGCCGATACAGGCGGGA
CGAAGCAGCACGTGGCAGACATCGAGCACCCACAAGAAGGATCCGATAGAACGAGCGGTTAGCCCTGAGCCCATC
GACGCCAACGCCAGTATCGCCCTGGGTGTCGGCCAGAACGTGCTGCCTGTCACGGCAACCGAGGCGAATCGACAG
ACGGGCCGTACGGCAGCGCCCGAGCTTGACGCCAATGACCCCATCGCTGTTGCGCTGGCGGAGCTCAAGGACAAC
GGGGGCAAGCAGTCGTCGTTGAGAGTCTCGGCGGACCACTATCACGGTATCGCCACTCCGGCCCCGGGCACGGAG
AGCCGCACGACGCGGCCGGTGCCGGTGCCCGGGAGCCACGATGCCGCCATGGCCAGCCGCGGGACGCCTCCGCCC
TCGTATCAGCAGCCGGCGCAGGTGACGAGACTGGGAGTTCCACCGCCGGCAGTGACGTCCAAGGCTATGAAGGAG
GCGACGAAGAAGGTGACGGCGCAGACGCGTACCATCTTCGGAAACGACGTGAGAGCTGGCGGCGGGACTCAACGC
ACGTCTCCCGGCTTCCGGCCCCCGACGCGTGGCACCGACATACCCCGGGCGAAGTCGCCGGCTCCGGCCCGGAGC
GTATCGCCGCAGCCGCGGGCCAACAACGACGTGCGCGGCGGCGGCGGCTACCGATCGGCGTCGCCCAATCCCCAA
CGTCGCCACCACAGGGCGCAGTCCCAAGCTGCGACCCCCGGATCCAGACGCGGAGGCGAGCCGTCCATATACGGA
GGCGCATCGCCTGGCCGAGAAACGTCATCGTCGGCGCATCGGGACTACAACCGGCCTCAGAGCAGTTACGGCGCC
TCAGCCGATATGGCAGTGCAGTTGGCGCCGGCAGAAGACGATGGCTACGGGTCCCAACGCAGCCGGGGATCCGAG
TCATCGCGCGCCATGGGGCTCTATGACGGGGGAGGGACTCGTTCGCGAAGCAAGTCTGTGGCAGACCCGGCTCGG
CAGTACTCACGAGACGGACGGCCGATACTGCATTACGCGCGGGCTCTCTACATGTACCAAGCGGCCATACCGGAG
GAGCTGGGCTTCACCAAGGGAGACTTCCTGGCCGTCTTCCGCCACCAAGACGACGGTTGGTGGGAGGCCGAGATT
CACGGTGGCAACGGCCGGGTCGGATTGGTTCCGAGCAACTATCTTGTGCCATGCTAA
Gene >Ophcf2|01168
ATGCCCGCGGTGACGGCCGATGCTCCGGCGGTCGCGCTGTCCTGTGGGGATCCCGCTTGAAATCCGCTTCCCCCT
CTTACCCCCGTCTGCCTTTTACTGACAGATCGTCTTCACAGTCGCCAATAACTTTTGGGGCAAGGACGATGCTGG
AGTCAACCCGCTCCTGGAGCGTATGCAGGGTGCCAAACAAACATGCGATGAACTGAGAGCCTTTTACGGCGGTAA
GTCTCGTCTTTCGTCTCTCAAGACTGTTCATCTCATATCCGTCGACTTCTGCAGCCCGCGCTACCATCGAAGATG
ATTACGCCAGAAAGCTTCTCAACCTGTGTCGAAAGTCTCTCGGAACCTACGAAATGGGGACGCTCAAGACTTCCC
TCGATACCGTACGCGGAGAACTCGAGTCCATGGCCAAGCAGCACCAAAGTATCGCCGCCCAGATGAAGACAGAAC
TCGAAGAGCCGCTGGCCGCCTTCGCAGGGGGGATGAAGGAACGACGCAAGATTGTCCAGAACTCGGTCGAGAAGC
TGTTGAAAACCAAGATGCAGCAGACGCAACAAGTAAACAAGGTTAGTCTCTGGGTATCAGAGTCGATGGCTCGGG
TAGCGCTGACGCATCTGTCCCCTCAGACGCGAGACAAGTACGAGCAGGAGTGCCTCAAGATCAAGGGATACCTCG
CCCAGGGCCACATGGTCATGGGCCAGGAGGAGCGCCGGAACAAGGCGAAGCTGGAGAAGACACAGATCAGCCTCG
CCACGGCCAATACCGAGTACGAATACGCCGTCAAGGCCCTCGAGGAGACGACGGCGAGGTGGAACAGAGAGTGGA
AGGCCGCCGCGGACAAGTTTCAAGACCTCGAGGAGGAGCGCCTCGACTTCACCAAGAGCAGCCTGTGGACATTTG
CCAACATCGCCTCGACTGTCTGCGTCAGCGACGACGCTTCGTGCGAGAAGATACGCCTATCTCTGGAGACGATGG
AGGTGGAAAGGGACATTGTCCACTTCATCAGCGAACGGGGGACCGGCCAAGAGATTCCTGATCCGCCAAAGTACA
TCAACTTTTGTCGTGGAGACGTGACCGACAGCCAGTCGGAGGCGTCCGAGGACGACAACTACTCGGTGGCTCAGT
TCCCTCGCAGCATTAACCCGGCCTTTCGATCATCATCGCCCCAGCCGTCGACGTTTGAGTCACACCATGATCCCA
ATTCAGCCTTGGCCAACAACCTGGCTCATAGGGAGCCCATGCCGTCGACAAGCCGTGAGGCCACGTTGACGCCCC
AGAAGACGCCCAAGGCATCGAGGATGCCGGCTCACAACCAACATCCCGTACAGTCACCCTCCAGACACGAGCCAT
ACGATATCGATGCACACGAGCGTCTAGCGACTGTCCCGCACGACCCATATCCAATGGACGGCATGACGATGCTCT
GCCGCACCGCGCCGTCTTCAGACCGAGGCTCTCAGCCGACATCCGCCCGGCCGTCGAGCCGCGACTCGCAGGCCG
ATTACTCGGGCTCTATGTCGTCGTGCAGTCAGGACCTTACCAGCGGGAAGACGAGTCCGGCAAGGCAAGACCAGA
CTCCCGTGTCGAGCCCGGAGAAGCGCGTATTCAAGAAGAAGAGCGGCTTCTTTCAGAACCACAGTCCCTTCAGAC
GAAAGAGCACCAAGGAAATGTCGGTGCCGATACAGGCGGGACGAAGCAGCACGTGGCAGACATCGAGCACCCACA
AGAAGGATCCGATAGTTGGTGCCACCCAGCCAGACAGAACATGGTGGAGTAATGCTGACGACTTCATGTAGGAAC
GAGCGGTTAGCCCTGAGCCCATCGACGCCAACGCCAGTATCGCCCTGGGTGTCGGCCAGAACGTGCTGCCTGTCA
CGGCAACCGAGGCGAATCGACAGACGGGCCGTACGGCAGCGCCCGAGCTTGACGCCAATGACCCCATCGCTGTTG
CGCTGGCGGAGCTCAAGGACAACGGGGGCAAGCAGTCGTCGTTGAGAGTCTCGGCGGACCACTATCACGGTATCG
CCACTCCGGCCCCGGGCACGGAGAGCCGCACGACGCGGCCGGTGCCGGTGCCCGGGAGCCACGATGCCGCCATGG
CCAGCCGCGGGACGCCTCCGCCCTCGTATCAGCAGCCGGCGCAGGTGACGAGACTGGGAGTTCCACCGCCGGCAG
TGACGTCCAAGGCTATGAAGGAGGCGACGAAGAAGGTGACGGCGCAGACGCGTACCATCTTCGGAAACGACGTGA
GAGCTGGCGGCGGGACTCAACGCACGTCTCCCGGCTTCCGGCCCCCGACGCGTGGCACCGACATACCCCGGGCGA
AGTCGCCGGCTCCGGCCCGGAGCGTATCGCCGCAGCCGCGGGCCAACAACGACGTGCGCGGCGGCGGCGGCTACC
GATCGGCGTCGCCCAATCCCCAACGTCGCCACCACAGGGCGCAGTCCCAAGCTGCGACCCCCGGATCCAGACGCG
GAGGCGAGCCGTCCATATACGGAGGCGCATCGCCTGGCCGAGAAACGTCATCGTCGGCGCATCGGGACTACAACC
GGCCTCAGAGCAGTTACGGCGCCTCAGCCGATATGGCAGTGCAGTTGGCGCCGGCAGAAGACGATGGCTACGGGT
CCCAACGCAGCCGGGGATCCGAGTCATCGCGCGCCATGGGGCTCTATGACGGGGGAGGGACTCGTTCGCGAAGCA
AGTCTGTGGCAGACCCGGCTCGGCAGTACTCACGAGACGGACGGCCGATACTGCATTACGGTAAGTTGCGTTGCC
TGTAGATTTTCGAACCTCTGCTGACGATGAGAAAATCAGCGCGGGCTCTCTACATGTACCAAGCGGCCATACCGG
AGGAGCTGGGCTTCACCAAGGGAGACTTCCTGGCCGTCTTCCGCCACCAAGACGACGGTTGGTGGGAGGCCGAGA
TTCACGGTGGCAACGGCCGGGTCGGATTGGTTCCGAGCAACTATCTTGTGCCATGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail