Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01167
Gene name
Locationscaffold_01:4246743..4247984
Strand-
Gene length (bp)1241
Transcript length (bp)1134
Coding sequence length (bp)1134
Protein length (aa) 378

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06775 Seipin Putative adipose-regulatory protein (Seipin) 9.4E-56 32 246

GO

GO Term Description Terminal node
GO:0019915 lipid storage Yes
GO:0008150 biological_process No
GO:0051235 maintenance of location No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 239 261 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01167
MNKIKQTVEAATSKPMQRVAVNTALLVSGASTLFCVAALVTGIFFHNYVPHQLVRVPAHLQYGSGPNPYAVVSLT
RPPMIKTQQEYDVSVVLSIPRSPANVERGNFMVSLQLFEAEASAKLEADARVFAHAHDHFGTNKVLFASRRPALV
PYDDPFVSISKRLVLVLYHMLFPATQSYNMRVDLAERLAFVRSSDVPASAYVEIEAGQDIQIYRAALVMTAQMRG
LRWLMVHYRIFTYITATVVFWACEVLFMSLGWIVWASATGSRGAGKDTGRRPITKGEIKNERDQDESSEHAYAFP
TVGRQRPLRYEPEVKMEDDDSRGRSLAEVPVAGVEGDDEDEHKADDDRRRYDSGLGTSYSERGSSSVRRRASRSE
TE*
Coding >Ophcf2|01167
ATGAACAAAATCAAGCAGACTGTGGAGGCGGCGACGTCCAAGCCCATGCAAAGGGTCGCCGTCAACACAGCGCTC
CTTGTGTCAGGGGCATCTACGCTCTTCTGCGTCGCTGCCCTCGTGACAGGCATCTTCTTTCACAACTACGTGCCG
CACCAGCTCGTGAGGGTGCCTGCGCATCTTCAGTATGGGTCGGGCCCTAACCCTTACGCCGTTGTGTCCCTCACG
CGCCCGCCGATGATTAAGACTCAGCAGGAGTACGACGTGTCGGTAGTTCTCTCCATTCCGCGATCCCCGGCCAAC
GTCGAGCGCGGGAACTTCATGGTCTCCCTGCAACTGTTCGAAGCCGAGGCCAGCGCGAAGCTCGAAGCCGACGCC
CGTGTCTTTGCGCACGCACACGATCACTTTGGTACCAACAAGGTCCTCTTCGCGTCACGGCGTCCCGCTCTCGTA
CCCTACGATGACCCCTTTGTCTCCATATCAAAGCGCTTGGTTCTCGTGCTGTATCACATGCTCTTTCCCGCCACG
CAGTCGTACAACATGAGGGTCGACCTGGCTGAGCGGCTCGCCTTTGTCAGGAGCTCTGACGTGCCTGCTTCGGCC
TACGTCGAGATAGAAGCCGGGCAAGACATACAGATTTACCGAGCGGCTCTGGTCATGACAGCGCAGATGCGGGGT
CTACGCTGGCTCATGGTTCACTATCGCATCTTTACCTACATCACGGCCACGGTGGTCTTCTGGGCGTGCGAGGTC
TTATTCATGAGTCTTGGTTGGATCGTTTGGGCTTCAGCCACGGGCTCCAGGGGCGCTGGGAAAGACACGGGTCGC
CGTCCCATTACTAAAGGGGAGATTAAGAACGAGCGAGATCAGGACGAGTCGTCGGAACACGCATATGCGTTCCCC
ACTGTCGGAAGACAGCGGCCACTGAGATATGAGCCGGAGGTCAAGATGGAGGACGATGATAGCCGCGGTCGGTCC
CTGGCTGAAGTACCCGTCGCCGGGGTCGAAGGGGACGATGAGGACGAGCACAAGGCCGACGACGACAGGCGCAGA
TATGACTCTGGTCTGGGCACGAGCTATAGTGAAAGGGGCAGCAGCAGCGTTCGCAGGAGGGCGTCTCGGAGCGAG
ACGGAGTAA
Transcript >Ophcf2|01167
ATGAACAAAATCAAGCAGACTGTGGAGGCGGCGACGTCCAAGCCCATGCAAAGGGTCGCCGTCAACACAGCGCTC
CTTGTGTCAGGGGCATCTACGCTCTTCTGCGTCGCTGCCCTCGTGACAGGCATCTTCTTTCACAACTACGTGCCG
CACCAGCTCGTGAGGGTGCCTGCGCATCTTCAGTATGGGTCGGGCCCTAACCCTTACGCCGTTGTGTCCCTCACG
CGCCCGCCGATGATTAAGACTCAGCAGGAGTACGACGTGTCGGTAGTTCTCTCCATTCCGCGATCCCCGGCCAAC
GTCGAGCGCGGGAACTTCATGGTCTCCCTGCAACTGTTCGAAGCCGAGGCCAGCGCGAAGCTCGAAGCCGACGCC
CGTGTCTTTGCGCACGCACACGATCACTTTGGTACCAACAAGGTCCTCTTCGCGTCACGGCGTCCCGCTCTCGTA
CCCTACGATGACCCCTTTGTCTCCATATCAAAGCGCTTGGTTCTCGTGCTGTATCACATGCTCTTTCCCGCCACG
CAGTCGTACAACATGAGGGTCGACCTGGCTGAGCGGCTCGCCTTTGTCAGGAGCTCTGACGTGCCTGCTTCGGCC
TACGTCGAGATAGAAGCCGGGCAAGACATACAGATTTACCGAGCGGCTCTGGTCATGACAGCGCAGATGCGGGGT
CTACGCTGGCTCATGGTTCACTATCGCATCTTTACCTACATCACGGCCACGGTGGTCTTCTGGGCGTGCGAGGTC
TTATTCATGAGTCTTGGTTGGATCGTTTGGGCTTCAGCCACGGGCTCCAGGGGCGCTGGGAAAGACACGGGTCGC
CGTCCCATTACTAAAGGGGAGATTAAGAACGAGCGAGATCAGGACGAGTCGTCGGAACACGCATATGCGTTCCCC
ACTGTCGGAAGACAGCGGCCACTGAGATATGAGCCGGAGGTCAAGATGGAGGACGATGATAGCCGCGGTCGGTCC
CTGGCTGAAGTACCCGTCGCCGGGGTCGAAGGGGACGATGAGGACGAGCACAAGGCCGACGACGACAGGCGCAGA
TATGACTCTGGTCTGGGCACGAGCTATAGTGAAAGGGGCAGCAGCAGCGTTCGCAGGAGGGCGTCTCGGAGCGAG
ACGGAGTAA
Gene >Ophcf2|01167
ATGGTAAGCAGCCTGCCTACGGAATCAGTTCTCTAAACTGACCGTCTCAGAACAAAATCAAGCAGACTGTGGAGG
CGGCGACGTCCAAGCCCATGCAAAGGGTCGCCGTCAACACAGCGCTCCTTGTGTCAGGGGCATCTACGCTCTTCT
GCGTCGCTGCCCTCGTGACAGGCATCTTCTTTCACAACTACGTGCCGCACCAGCTCGTGAGGGTGCCTGCGCATC
TTCAGTATGGGTGAGTCTAATCTCTTCCCCACCGCGTGTGCTATCAAGCTAATGCGCCACGACTTCTCAGGTCGG
GCCCTAACCCTTACGCCGTTGTGTCCCTCACGCGCCCGCCGATGATTAAGACTCAGCAGGAGTACGACGTGTCGG
TAGTTCTCTCCATTCCGCGATCCCCGGCCAACGTCGAGCGCGGGAACTTCATGGTCTCCCTGCAACTGTTCGAAG
CCGAGGCCAGCGCGAAGCTCGAAGCCGACGCCCGTGTCTTTGCGCACGCACACGATCACTTTGGTACCAACAAGG
TCCTCTTCGCGTCACGGCGTCCCGCTCTCGTACCCTACGATGACCCCTTTGTCTCCATATCAAAGCGCTTGGTTC
TCGTGCTGTATCACATGCTCTTTCCCGCCACGCAGTCGTACAACATGAGGGTCGACCTGGCTGAGCGGCTCGCCT
TTGTCAGGAGCTCTGACGTGCCTGCTTCGGCCTACGTCGAGATAGAAGCCGGGCAAGACATACAGATTTACCGAG
CGGCTCTGGTCATGACAGCGCAGATGCGGGGTCTACGCTGGCTCATGGTTCACTATCGCATCTTTACCTACATCA
CGGCCACGGTGGTCTTCTGGGCGTGCGAGGTCTTATTCATGAGTCTTGGTTGGATCGTTTGGGCTTCAGCCACGG
GCTCCAGGGGCGCTGGGAAAGACACGGGTCGCCGTCCCATTACTAAAGGGGAGATTAAGAACGAGCGAGATCAGG
ACGAGTCGTCGGAACACGCATATGCGTTCCCCACTGTCGGAAGACAGCGGCCACTGAGATATGAGCCGGAGGTCA
AGATGGAGGACGATGATAGCCGCGGTCGGTCCCTGGCTGAAGTACCCGTCGCCGGGGTCGAAGGGGACGATGAGG
ACGAGCACAAGGCCGACGACGACAGGCGCAGATATGACTCTGGTCTGGGCACGAGCTATAGTGAAAGGGGCAGCA
GCAGCGTTCGCAGGAGGGCGTCTCGGAGCGAGACGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail