Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01163
Gene name
Locationscaffold_01:4235345..4237408
Strand+
Gene length (bp)2063
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00790 VHS VHS domain 1.0E-36 9 140
PF00018 SH3_1 SH3 domain 6.9E-16 226 270
PF14604 SH3_9 Variant SH3 domain 1.3E-14 227 275
PF07653 SH3_2 Variant SH3 domain 2.9E-13 224 276
PF03127 GAT GAT domain 1.3E-10 300 371

GO

GO Term Description Terminal node
GO:0043130 ubiquitin binding Yes
GO:0035091 phosphatidylinositol binding Yes
GO:0005515 protein binding Yes
GO:0005543 phospholipid binding No
GO:0032182 ubiquitin-like protein binding No
GO:0008289 lipid binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole 0.499 0.4043 0.0438 0.1103 0.0438 0.0012 0.2378 0.6371 0.4254 0.0045

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2776
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7092
Ophiocordyceps australis map64 (Brazil) OphauB2|7046
Ophiocordyceps camponoti-floridani Ophcf2|01163 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2201
Ophiocordyceps kimflemingae Ophio5|4640
Ophiocordyceps subramaniannii Hirsu2|4426

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01163
MFRAAATGPFDEVVAKATDENLTSEDWGAIMEVCDKVSGDQNGPKEAVQSMMKRLAHRNANVQLYTLELAHALCQ
NCGLPIHREISSRAFTDSLLRLANDRNTHGQVKAKILEKMKDWSDMFGNDSELGVMYDAYHRLKQSNPTLQAPSA
PQKQGLTESDRQKEEDELQMALRLSLQDEERKKAAPAAAAGAVSGTHTASAGQQHGSGATPSVPAGTTAATVSRV
RALYDFVPSEAGELEFKKGDVIAVLESVYKDWWRGSLKGKTGIFPLNYVEKLTDPTPEELQREAQMEAEVFAEIK
NVEKLLTLLSTSNTAPREEDNDEISKLYHQTLAIRPKLIKLIEKYSQKKDDFTQLNEKFIKARRDYEALLESSMS
QPPQHNYHQYAMRPGPPGQAYGPGAGEYGAHETAKYYASGPHGDPQQQQQQQQAPSSAPFYVAGTEVPSQSSHQP
VYPPREPSPRHTKQQQQQQQQQHAPSSPQTYALYSQAPPSSQPRPTSTYGAQELATSAYDSPVVSHNASFASQQQ
PQQQQQGSSSAAYAQQQVHYQGYNPPDHAPPPAPDGQPPGEQRYKPYVPPSGGPSAPNPSDYYR*
Coding >Ophcf2|01163
ATGTTCCGAGCAGCAGCAACGGGCCCCTTTGACGAGGTCGTCGCCAAGGCGACCGACGAGAACCTCACGTCGGAG
GACTGGGGAGCCATCATGGAAGTCTGCGACAAGGTCTCGGGCGACCAGAACGGCCCCAAAGAGGCTGTCCAGAGC
ATGATGAAGCGGCTGGCTCACCGCAACGCCAACGTTCAGCTCTACACGCTCGAGCTGGCCCATGCCCTCTGCCAG
AACTGCGGGCTGCCCATCCACCGCGAAATCTCGAGCCGGGCCTTTACCGACTCTCTGCTACGGCTGGCTAACGAT
CGTAACACGCACGGCCAGGTCAAGGCCAAGATCCTGGAGAAGATGAAGGACTGGAGCGACATGTTCGGCAACGAC
TCGGAGCTTGGCGTCATGTACGACGCCTACCATCGGTTGAAGCAGAGCAACCCGACGCTACAGGCCCCCAGCGCA
CCGCAGAAGCAGGGCCTCACCGAGTCGGATCGGCAGAAGGAGGAGGACGAGCTGCAGATGGCGCTGAGGCTGAGT
CTGCAGGACGAGGAACGCAAGAAGGCGGCACCCGCGGCCGCTGCTGGTGCCGTCTCGGGCACTCATACAGCTTCG
GCTGGCCAACAGCACGGGTCCGGGGCGACGCCGTCTGTACCGGCGGGGACGACGGCCGCGACGGTCAGCCGGGTG
AGGGCCCTCTACGACTTCGTTCCCTCGGAGGCGGGCGAGCTCGAGTTCAAAAAGGGCGACGTCATCGCCGTGCTC
GAGAGCGTCTATAAGGACTGGTGGCGGGGGTCACTCAAGGGCAAGACGGGCATCTTTCCGCTCAACTACGTCGAG
AAGCTCACGGATCCGACGCCCGAGGAGCTGCAGCGCGAGGCCCAGATGGAGGCCGAGGTGTTTGCCGAGATCAAG
AACGTCGAGAAGCTGCTGACGCTGCTGAGCACGTCTAACACGGCGCCGCGGGAGGAGGATAATGATGAGATTTCG
AAGCTCTATCATCAGACGCTGGCTATCCGGCCGAAACTGATCAAGCTCATTGAAAAGTACTCCCAGAAGAAGGAT
GACTTTACGCAGCTCAACGAAAAGTTCATCAAGGCCCGTCGAGACTACGAGGCTCTGCTCGAGTCGTCCATGTCG
CAGCCGCCTCAGCACAACTACCATCAGTACGCCATGAGACCGGGGCCGCCGGGCCAGGCCTACGGTCCCGGTGCC
GGAGAATACGGCGCTCACGAGACGGCCAAGTACTACGCTTCCGGGCCGCACGGAGATCCGCAGCAGCAGCAGCAG
CAGCAGCAGGCCCCCTCGTCAGCACCCTTCTACGTGGCCGGAACAGAGGTCCCCTCCCAGTCAAGCCATCAGCCC
GTATACCCACCACGAGAGCCATCGCCACGGCACACCAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCTCCA
TCTTCACCGCAGACTTACGCCCTCTACTCACAGGCTCCCCCATCGAGCCAGCCGCGGCCGACGAGCACGTACGGC
GCTCAGGAGCTGGCCACGTCGGCGTACGACTCGCCCGTCGTGTCGCACAATGCTAGCTTCGCGTCACAGCAGCAG
CCACAGCAGCAGCAGCAAGGGTCGTCATCGGCTGCGTACGCTCAGCAGCAGGTTCACTATCAGGGTTACAATCCG
CCCGATCATGCGCCGCCGCCTGCGCCGGACGGACAGCCGCCGGGGGAGCAGAGGTATAAGCCCTACGTCCCGCCG
AGCGGAGGGCCTAGTGCGCCGAATCCGAGTGATTACTATCGCTAG
Transcript >Ophcf2|01163
ATGTTCCGAGCAGCAGCAACGGGCCCCTTTGACGAGGTCGTCGCCAAGGCGACCGACGAGAACCTCACGTCGGAG
GACTGGGGAGCCATCATGGAAGTCTGCGACAAGGTCTCGGGCGACCAGAACGGCCCCAAAGAGGCTGTCCAGAGC
ATGATGAAGCGGCTGGCTCACCGCAACGCCAACGTTCAGCTCTACACGCTCGAGCTGGCCCATGCCCTCTGCCAG
AACTGCGGGCTGCCCATCCACCGCGAAATCTCGAGCCGGGCCTTTACCGACTCTCTGCTACGGCTGGCTAACGAT
CGTAACACGCACGGCCAGGTCAAGGCCAAGATCCTGGAGAAGATGAAGGACTGGAGCGACATGTTCGGCAACGAC
TCGGAGCTTGGCGTCATGTACGACGCCTACCATCGGTTGAAGCAGAGCAACCCGACGCTACAGGCCCCCAGCGCA
CCGCAGAAGCAGGGCCTCACCGAGTCGGATCGGCAGAAGGAGGAGGACGAGCTGCAGATGGCGCTGAGGCTGAGT
CTGCAGGACGAGGAACGCAAGAAGGCGGCACCCGCGGCCGCTGCTGGTGCCGTCTCGGGCACTCATACAGCTTCG
GCTGGCCAACAGCACGGGTCCGGGGCGACGCCGTCTGTACCGGCGGGGACGACGGCCGCGACGGTCAGCCGGGTG
AGGGCCCTCTACGACTTCGTTCCCTCGGAGGCGGGCGAGCTCGAGTTCAAAAAGGGCGACGTCATCGCCGTGCTC
GAGAGCGTCTATAAGGACTGGTGGCGGGGGTCACTCAAGGGCAAGACGGGCATCTTTCCGCTCAACTACGTCGAG
AAGCTCACGGATCCGACGCCCGAGGAGCTGCAGCGCGAGGCCCAGATGGAGGCCGAGGTGTTTGCCGAGATCAAG
AACGTCGAGAAGCTGCTGACGCTGCTGAGCACGTCTAACACGGCGCCGCGGGAGGAGGATAATGATGAGATTTCG
AAGCTCTATCATCAGACGCTGGCTATCCGGCCGAAACTGATCAAGCTCATTGAAAAGTACTCCCAGAAGAAGGAT
GACTTTACGCAGCTCAACGAAAAGTTCATCAAGGCCCGTCGAGACTACGAGGCTCTGCTCGAGTCGTCCATGTCG
CAGCCGCCTCAGCACAACTACCATCAGTACGCCATGAGACCGGGGCCGCCGGGCCAGGCCTACGGTCCCGGTGCC
GGAGAATACGGCGCTCACGAGACGGCCAAGTACTACGCTTCCGGGCCGCACGGAGATCCGCAGCAGCAGCAGCAG
CAGCAGCAGGCCCCCTCGTCAGCACCCTTCTACGTGGCCGGAACAGAGGTCCCCTCCCAGTCAAGCCATCAGCCC
GTATACCCACCACGAGAGCCATCGCCACGGCACACCAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCTCCA
TCTTCACCGCAGACTTACGCCCTCTACTCACAGGCTCCCCCATCGAGCCAGCCGCGGCCGACGAGCACGTACGGC
GCTCAGGAGCTGGCCACGTCGGCGTACGACTCGCCCGTCGTGTCGCACAATGCTAGCTTCGCGTCACAGCAGCAG
CCACAGCAGCAGCAGCAAGGGTCGTCATCGGCTGCGTACGCTCAGCAGCAGGTTCACTATCAGGGTTACAATCCG
CCCGATCATGCGCCGCCGCCTGCGCCGGACGGACAGCCGCCGGGGGAGCAGAGGTATAAGCCCTACGTCCCGCCG
AGCGGAGGGCCTAGTGCGCCGAATCCGAGTGATTACTATCGCTAG
Gene >Ophcf2|01163
ATGTTCCGAGCAGCAGCAACGGGCCCCTTTGACGAGGTCGTCGGTGAGTCTCTCTTTCCGGTTCCCGCCATCCGC
ATACACTGACAACAGAGGCAGCCAAGGCGACCGACGAGAACCTCACGTCGGAGGACTGGGGAGCCATCATGGAAG
TCTGCGACAAGGTCTCGGGCGACCAGAACGGCCCCAAAGAGGCTGTCCAGAGCATGATGAAGCGGCTGGCTCACC
GCAACGCCAACGTTCAGCTCTACACGCTCGAGGTCTGTCCCTGCCTCCCAATATCTGCTCGTGCCGAGGACTGAC
GTTACGAGTCGCCAGCTGGCCCATGCCCTCTGCCAGAACTGCGGGCTGCCCATCCACCGCGAAATCTCGAGCCGG
GCCTTTACCGACTCTCTGCTACGGCTGGCTAACGATCGTAACACGCACGGCCAGGTCAAGGCCAAGATCCTGGAG
AAGATGAAGGACTGGAGCGACATGTTCGGCAACGACTCGGAGCTTGGCGTCATGTACGACGCCTACCATCGGTTG
AAGCAGAGCAACCCGACGCTACAGGCCCCCAGCGCACCGCAGAAGCAGGGCCTCACCGAGTCGGATCGGCAGAAG
GAGGAGGACGAGCTGCAGATGGCGCTGAGGCTGAGTCTGCAGGACGAGGAACGCAAGAAGGCGGCACCCGCGGCC
GCTGCTGGTGCCGTCTCGGGCACTCATACAGCTTCGGCTGGCCAACAGCACGGGTCCGGGGCGACGCCGTCTGTA
CCGGCGGGGACGACGGCCGCGACGGTCAGCCGGGTGAGGGCCCTCTACGACTTCGTTCCCTCGGAGGCGGGCGAG
CTCGAGTTCAAAAAGGGCGACGTCATCGCCGTGCTCGAGAGCGTCTATAAGGACTGGTGGCGGGGGTCACTCAAG
GGCAAGACGGGCATCTTTCCGCTCAACTACGTCGAGAAGCTCACGGATCCGACGCCCGAGGAGCTGCAGCGCGAG
GCCCAGATGGAGGCCGAGGTGTTTGCCGAGATCAAGAACGTCGAGAAGCTGCTGACGCTGCTGAGCACGTCTAAC
ACGGCGCCGCGGGAGGAGGATAATGATGAGATTTCGGTACGTCGACATGGTTCAGCCTCTCTTGTCTTGACTGAC
GACGAGGCGCAGAAGCTCTATCATCAGACGCTGGCTATCCGGCCGAAACTGATCAAGCTCATTGAAAAGTACTCC
CAGAAGAAGGGTAAGGAGGCTTCCATGCTTCCGTCTCTCATCTTGTCAGCCGCAGACACTGACGGACGATAGATG
ACTTTACGCAGCTCAACGAAAAGTTCATCAAGGCCCGTCGAGACTACGAGGCTCTGCTCGAGTCGTCCATGTCGC
AGCCGCCTCAGCACAACTACCATCAGTACGCCATGAGACCGGGGCCGCCGGGCCAGGCCTACGGTCCCGGTGCCG
GAGAATACGGCGCTCACGAGACGGCCAAGTACTACGCTTCCGGGCCGCACGGAGGTATCTCAACAGGCCCATTCA
GATGTATCACTTGCTCGTTCGTTTTCTAACTCGTTATTTCTTTTCTAGATCCGCAGCAGCAGCAGCAGCAGCAGC
AGGCCCCCTCGTCAGCACCCTTCTACGTGGCCGGAACAGAGGTCCCCTCCCAGTCAAGCCATCAGCCCGTATACC
CACCACGAGAGCCATCGCCACGGCACACCAAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCACGCTCCATCTTCAC
CGCAGACTTACGCCCTCTACTCACAGGCTCCCCCATCGAGCCAGCCGCGGCCGACGAGCACGTACGGCGCTCAGG
AGCTGGCCACGTCGGCGTACGACTCGCCCGTCGTGTCGCACAATGCTAGCTTCGCGTCACAGCAGCAGCCACAGC
AGCAGCAGCAAGGGTCGTCATCGGCTGCGTACGCTCAGCAGCAGGTTCACTATCAGGGTTACAATCCGCCCGATC
ATGCGCCGCCGCCTGCGCCGGACGGACAGCCGCCGGGGGAGCAGAGGTATAAGCCCTACGTCCCGCCGAGCGGAG
GGCCTAGTGCGCCGAATCCGAGTGATTACTATCGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail