Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01156
Gene name
Locationscaffold_01:4213878..4215713
Strand-
Gene length (bp)1835
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01417 ENTH ENTH domain 3.0E-50 15 139
PF08226 DUF1720 Domain of unknown function (DUF1720) 2.6E-06 258 343

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6437 0.2213 0.0113 0.2257 0.096 0.0016 0.0648 0.4551 0.5416 0.0051

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1845
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1648
Ophiocordyceps australis map64 (Brazil) OphauB2|7041
Ophiocordyceps camponoti-floridani Ophcf2|01156 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|74
Ophiocordyceps kimflemingae Ophio5|3083
Ophiocordyceps subramaniannii Hirsu2|1850

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01156
MSKVMRSVKNVTKGYSSTQVKVREATSNDPWGPTGTQMSEIAQMTFNTSTEFYDIMDMVDKRLNDKGKNWRHVLK
ALKVLDYCLHEGSEMVVTWARQNVYIIKTLREFQYIDEDGRDVGQNVRVAAKELTSLILDENRLRAERSDRRTWK
SRVSGLEDHPPPQHGQHSQHGQYGAEAPDPRRLPKRPVGDEDDTEYRLAIEASKQQEEEDRRKREGQNNDDDLAK
AIKLSKEEEERRRRALEDGNASLFDDDLLQLDQPQYTGFNQGYQQGNQVDFFANPIDQSQMQAQPTGYPYAGFQT
QPTGFQPQPTGFQPQPTGFQPGYGMDPYGQHGMQGFQPQPTGFNPYAQQQLSMQTGAAAEPALQPGSNNPWATNN
SQQQQQQALKPAATGSNNPFASGIQFGRPATAKPAISSLGSLPEREPLASFSQPKPRPQPQPQPQSYNPPPQKNM
TDYESKLNSLLATGDGMDTYGNTGELRIPAQHTAPGTYANSAGSGVQRLNAEPTGSNPFMRQQFTGMPAVSYGAQ
ASSATGAGGANPFGAQRPQQQASNQDLIQF*
Coding >Ophcf2|01156
ATGTCCAAGGTAATGCGCAGCGTCAAAAATGTGACCAAGGGCTATTCCAGCACTCAGGTCAAGGTCAGAGAGGCC
ACGAGCAATGATCCCTGGGGCCCGACAGGCACGCAGATGAGCGAAATAGCCCAGATGACTTTCAACACATCGACC
GAGTTTTACGACATTATGGACATGGTCGATAAACGATTAAACGACAAGGGCAAGAACTGGCGGCACGTTCTGAAG
GCTCTCAAAGTCCTTGACTACTGTCTTCACGAGGGTTCCGAAATGGTTGTCACCTGGGCCCGCCAGAACGTCTAC
ATCATCAAGACGCTGCGCGAGTTCCAGTACATCGACGAGGATGGTCGCGACGTGGGCCAAAATGTCCGCGTTGCT
GCCAAAGAGCTCACATCTTTGATCCTCGACGAGAACCGACTTCGTGCCGAGCGCAGCGATCGTAGAACGTGGAAA
TCTCGAGTCAGTGGTCTGGAGGACCACCCCCCGCCGCAGCATGGTCAGCACAGTCAGCATGGGCAATACGGAGCT
GAGGCCCCGGATCCGCGGCGGCTCCCGAAGCGGCCCGTGGGAGATGAAGATGATACCGAGTACCGGCTGGCCATC
GAGGCCAGCAAGCAGCAGGAAGAGGAGGATAGGAGAAAAAGGGAAGGCCAGAACAACGACGACGACTTAGCAAAG
GCTATCAAGCTCAGCAAGGAAGAGGAGGAGAGGAGGCGTCGGGCACTCGAAGATGGAAATGCCTCTCTGTTTGAT
GACGACCTGCTGCAGCTTGACCAGCCGCAGTATACCGGCTTCAACCAGGGCTATCAGCAAGGAAACCAGGTCGAC
TTCTTCGCCAACCCTATCGACCAGAGCCAAATGCAAGCGCAGCCCACCGGATATCCCTATGCCGGCTTTCAGACA
CAGCCGACTGGTTTCCAGCCCCAACCTACTGGCTTCCAGCCTCAGCCCACCGGTTTCCAGCCCGGCTATGGCATG
GATCCTTATGGCCAGCACGGCATGCAAGGCTTCCAGCCGCAGCCGACGGGCTTCAACCCCTACGCTCAACAGCAG
CTGTCGATGCAGACCGGGGCCGCGGCCGAGCCCGCTCTCCAGCCAGGAAGCAATAACCCTTGGGCCACTAACAAC
TCGCAGCAGCAACAGCAGCAGGCTCTGAAGCCGGCCGCGACGGGCTCCAACAATCCGTTCGCCTCTGGTATCCAA
TTCGGTCGTCCTGCCACAGCCAAGCCCGCCATATCCTCGCTAGGGTCGTTGCCTGAACGAGAGCCTTTGGCTTCA
TTCAGTCAGCCCAAGCCCCGACCGCAACCGCAACCGCAGCCGCAGTCGTACAACCCGCCGCCGCAGAAGAACATG
ACGGACTACGAGTCCAAGCTCAACTCCCTTCTTGCCACTGGCGATGGTATGGACACGTACGGCAACACTGGCGAG
CTCCGTATTCCGGCCCAACATACGGCGCCGGGAACGTATGCCAACAGCGCCGGCTCGGGAGTGCAACGGTTAAAC
GCGGAGCCGACCGGAAGCAACCCCTTTATGAGACAGCAGTTCACCGGCATGCCGGCCGTCAGCTACGGCGCCCAA
GCCTCTTCGGCCACGGGAGCAGGCGGTGCCAACCCTTTCGGAGCTCAGCGGCCGCAGCAACAAGCGTCCAACCAG
GACCTCATTCAGTTCTGA
Transcript >Ophcf2|01156
ATGTCCAAGGTAATGCGCAGCGTCAAAAATGTGACCAAGGGCTATTCCAGCACTCAGGTCAAGGTCAGAGAGGCC
ACGAGCAATGATCCCTGGGGCCCGACAGGCACGCAGATGAGCGAAATAGCCCAGATGACTTTCAACACATCGACC
GAGTTTTACGACATTATGGACATGGTCGATAAACGATTAAACGACAAGGGCAAGAACTGGCGGCACGTTCTGAAG
GCTCTCAAAGTCCTTGACTACTGTCTTCACGAGGGTTCCGAAATGGTTGTCACCTGGGCCCGCCAGAACGTCTAC
ATCATCAAGACGCTGCGCGAGTTCCAGTACATCGACGAGGATGGTCGCGACGTGGGCCAAAATGTCCGCGTTGCT
GCCAAAGAGCTCACATCTTTGATCCTCGACGAGAACCGACTTCGTGCCGAGCGCAGCGATCGTAGAACGTGGAAA
TCTCGAGTCAGTGGTCTGGAGGACCACCCCCCGCCGCAGCATGGTCAGCACAGTCAGCATGGGCAATACGGAGCT
GAGGCCCCGGATCCGCGGCGGCTCCCGAAGCGGCCCGTGGGAGATGAAGATGATACCGAGTACCGGCTGGCCATC
GAGGCCAGCAAGCAGCAGGAAGAGGAGGATAGGAGAAAAAGGGAAGGCCAGAACAACGACGACGACTTAGCAAAG
GCTATCAAGCTCAGCAAGGAAGAGGAGGAGAGGAGGCGTCGGGCACTCGAAGATGGAAATGCCTCTCTGTTTGAT
GACGACCTGCTGCAGCTTGACCAGCCGCAGTATACCGGCTTCAACCAGGGCTATCAGCAAGGAAACCAGGTCGAC
TTCTTCGCCAACCCTATCGACCAGAGCCAAATGCAAGCGCAGCCCACCGGATATCCCTATGCCGGCTTTCAGACA
CAGCCGACTGGTTTCCAGCCCCAACCTACTGGCTTCCAGCCTCAGCCCACCGGTTTCCAGCCCGGCTATGGCATG
GATCCTTATGGCCAGCACGGCATGCAAGGCTTCCAGCCGCAGCCGACGGGCTTCAACCCCTACGCTCAACAGCAG
CTGTCGATGCAGACCGGGGCCGCGGCCGAGCCCGCTCTCCAGCCAGGAAGCAATAACCCTTGGGCCACTAACAAC
TCGCAGCAGCAACAGCAGCAGGCTCTGAAGCCGGCCGCGACGGGCTCCAACAATCCGTTCGCCTCTGGTATCCAA
TTCGGTCGTCCTGCCACAGCCAAGCCCGCCATATCCTCGCTAGGGTCGTTGCCTGAACGAGAGCCTTTGGCTTCA
TTCAGTCAGCCCAAGCCCCGACCGCAACCGCAACCGCAGCCGCAGTCGTACAACCCGCCGCCGCAGAAGAACATG
ACGGACTACGAGTCCAAGCTCAACTCCCTTCTTGCCACTGGCGATGGTATGGACACGTACGGCAACACTGGCGAG
CTCCGTATTCCGGCCCAACATACGGCGCCGGGAACGTATGCCAACAGCGCCGGCTCGGGAGTGCAACGGTTAAAC
GCGGAGCCGACCGGAAGCAACCCCTTTATGAGACAGCAGTTCACCGGCATGCCGGCCGTCAGCTACGGCGCCCAA
GCCTCTTCGGCCACGGGAGCAGGCGGTGCCAACCCTTTCGGAGCTCAGCGGCCGCAGCAACAAGCGTCCAACCAG
GACCTCATTCAGTTCTGA
Gene >Ophcf2|01156
ATGTCCAAGGTAATGCGCAGCGTCAAAAATGTGACCAAGGGCTATTCCAGCACTCAGGTCAAGGTCAGAGAGGGT
GGGTCGAGCCTCAAGACCTTGTTTCTCTTGCGCTGACCTTTGTTGAAGCCACGAGCAATGATCCCTGGGGCCCGA
CAGGCACGCAGATGAGCGAAATAGCCCAGATGACTTTCAACACGTACGAAGCCTCCCTCCCGCCGTGATGGCGCC
GCTGACCGACTTACTCTCATATCAGATCGACCGAGTTTTACGACATTATGGACATGGTCGATAAACGATTAAACG
ACAAGGGCAAGAACTGGCGGCACGTTCTGAAGGCTCTCAAAGTCCTTGACTACTGTCTTCACGAGGGTTCCGAAA
TGGTTGTCACCTGGGCCCGCCAGAACGTCTACATCATCAAGACGCTGCGCGAGTTCCAGTACATCGACGAGGATG
GTCGCGACGTGGGCCAAAATGGTAAACTCATCTGCTCCAAAACCCCCCCAATGCCAAGTCTTGTCTGCTGACATT
GTCAAGTCCGCGTTGCTGCCAAAGAGCTCACATCTTTGATCCTCGACGAGAACCGACTTCGTGCCGAGCGCAGCG
ATCGTAGAACGTGGAAATCTCGAGTCAGTGGTCTGGAGGACCACCCCCCGCCGCAGCATGGTCAGCACAGTCAGC
ATGGGCAATACGGAGCTGAGGCCCCGGATCCGCGGCGGCTCCCGAAGCGGCCCGTGGGAGATGAAGATGATACCG
AGTACCGGCTGGCCATCGAGGCCAGCAAGCAGCAGGAAGAGGAGGATAGGAGAAAAAGGGAAGGCCAGAACAACG
ACGACGACTTAGCAAAGGCTATCAAGCTCAGCAAGGAAGAGGAGGAGAGGAGGCGTCGGGCACTCGAAGATGGAA
ATGCCTCTCTGTTTGATGACGACCTGCTGCAGCTTGACCAGCCGCAGTATACCGGCTTCAACCAGGGCTATCAGC
AAGGAAACCAGGTCGACTTCTTCGCCAACCCTATCGACCAGAGCCAAATGCAAGCGCAGCCCACCGGATATCCCT
ATGCCGGCTTTCAGACACAGCCGACTGGTTTCCAGCCCCAACCTACTGGCTTCCAGCCTCAGCCCACCGGTTTCC
AGCCCGGCTATGGCATGGATCCTTATGGCCAGCACGGCATGCAAGGCTTCCAGCCGCAGCCGACGGGCTTCAACC
CCTACGCTCAACAGCAGCTGTCGATGCAGACCGGGGCCGCGGCCGAGCCCGCTCTCCAGCCAGGAAGCAATAACC
CTTGGGCCACTAACAACTCGCAGCAGCAACAGCAGCAGGCTCTGAAGCCGGCCGCGACGGGCTCCAACAATCCGT
TCGCCTCTGGTATCCAATTCGGTCGTCCTGCCACAGCCAAGCCCGCCATATCCTCGCTAGGGTCGTTGCCTGAAC
GAGAGCCTTTGGCTTCATTCAGTCAGCCCAAGCCCCGACCGCAACCGCAACCGCAGCCGCAGTCGTACAACCCGC
CGCCGCAGAAGAACATGACGGACTACGAGTCCAAGCTCAACTCCCTTCTTGCCACTGGCGATGGTATGGACACGT
ACGGCAACACTGGCGAGCTCCGTATTCCGGCCCAACATACGGCGCCGGGAACGTATGCCAACAGCGCCGGCTCGG
GAGTGCAACGGTTAAACGCGGAGCCGACCGGAAGCAACCCCTTTATGAGACAGCAGTTCACCGGCATGCCGGCCG
TCAGCTACGGCGCCCAAGCCTCTTCGGCCACGGGAGCAGGCGGTGCCAACCCTTTCGGAGCTCAGCGGCCGCAGC
AACAAGCGTCCAACCAGGACCTCATTCAGTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail