Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01154
Gene name
Locationscaffold_01:4205338..4211502
Strand-
Gene length (bp)6164
Transcript length (bp)5862
Coding sequence length (bp)5862
Protein length (aa) 1954

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12110 Nup96 Nuclear protein 96 3.0E-92 1485 1782
PF04096 Nucleoporin2 Nucleoporin autopeptidase 2.2E-46 893 1037
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.1E+01 43 136
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 6.0E+00 111 184
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.3E+02 143 205
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.1E-01 254 336
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 6.3E-03 341 420
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 6.6E-09 400 486
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 6.0E-10 457 557
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 5.1E-06 546 621

GO

GO Term Description Terminal node
GO:0006913 nucleocytoplasmic transport Yes
GO:0005643 nuclear pore Yes
GO:0017056 structural constituent of nuclear pore Yes
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0051169 nuclear transport No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0140513 nuclear protein-containing complex No
GO:0006810 transport No
GO:0032991 protein-containing complex No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0046907 intracellular transport No
GO:0051179 localization No
GO:0051641 cellular localization No
GO:0005198 structural molecule activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3631 0.6922 0.0589 0.0726 0.1276 0.0062 0.1439 0.0606 0.1709 0.0025

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1843
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1650
Ophiocordyceps australis map64 (Brazil) OphauB2|7039
Ophiocordyceps camponoti-floridani Ophcf2|01154 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|76
Ophiocordyceps kimflemingae Ophio5|3081
Ophiocordyceps subramaniannii Hirsu2|1848

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01154
MSFGSSGFGGFGSNNNQTSSGFGSGFGSNNNNSGTGFGSNTGGGFGQSTNTGGGVFGNATQSGFGSPSGGFGSNA
GGGFGSKPAFGSSNTAGGGLFGASNANNTTSNSGFGGFGSTNNANSSPFGGGNTTGGGLFGNSANKTGFGAAANT
GSSLFGATNTSSGGGFGGSGFGAASNPAAAVGDPPGTGATPFTAFVEKEPNSTNQSNSFQNILFQDPYRKWSAEE
LRLADYVQGRRHGNANGAGAFGVNSGFGGGFGSNNNQTTNAFGTPSNAGGGLFGAGNASTNNNAGGFGQAAAGAF
GANSGNASGGLFGNSNKPSGGLFGNPTTQQSSGLFGSGTGGGFGANNNNNTSAFGGTANTAGGLFGSSNQANKPQ
GTGFSFGNANANNTTSAFGGSNTGGAFGTANSGNSGLFGASNNQQSSGGLFGNAQQQQQPNTNSPFGSGFGAQNQ
SQNPQGLFGNAQQKPASSGLFGAATTTTTPTNSLFGSANNQQQGTSAFGTNNTAATGGLFGAPKPSATTSLFGAP
NANQANSTGTGLFGALGSNNQAQPTTGSSLFGTANNTQQKPGGLFGTTNQASGSSLFGGTNNQVQGNSLFGNGAN
QQQTQSSGFGGSLLGGTQQLGNAPQGLTANLNDVSAYGSPSLFAGLSGNEVSNPGPLATPLNSSSKPRRSSILPM
YKLAPSTASRFATPQKRGFGFSYSSFGTPGASPAGSISSTPGGLGRSLLGPGGSGTLSKSMSTNNLRRSFAAEDS
ILAPGAFSSSSNGHWYGSTGSKKLVINRDIRSDLFSSPQRDKQSVDGAASARKLSKRVSFDTSNVEDENGTPPRN
ALPASEDTPSSETQDSTPRQNRSLTAANGMKTPDMEHVKGNELAIVHEEDHTATPESPDTPSRDRAPGQYWMNPD
KEGFFNMNRMQRQRIAGFSVGRENVGHITFKLPVDISGINIDDICGTIVVLEPRSATVYPNQAKKPPVGRGLNVP
ATILLEQSWPRGGRQRRSSGDFKRFSRHVERLREIPDTTFESFDESTGTWVFSVEHFTTYGLKDESDYESDEDDE
GDLVMTAPTARSRVVSESSVNPASGGESFSSSHSRDLPGAFDGRMEPLDGNDAAKPSFFGNSSADLTSNNVQLSL
EEYDTHMDDGYDVSEDEDVARSSVGHHRAAEQEDSSPEADQEPRRATPGGILRARMRAMKDSIGPVRLEVPDGDD
WMSMLMKTVSPAKRDRQQLREQNETPSKRRCVGNPVGLDEDDEVFGTSSMLDRSPSKAGQASAAMTKLAMDKGQG
FATSIDLMNSLFDKSRFAKTPVASTPKKGLPEWPYERQDKSWVVGEAEQSYHNASRPTWGPGEVLVVTRSLETAQ
SFRNGSNILAFQLSGIQTQLQDVRLAKFSITSSQTLLLAQQGMTEIGLIDGVPMATLHVARLRDLFHHQDVQSAA
NVHEKHVWELSSILFDRLAPSDASDGNEDSTRKTMLSKFWTDLVEQASTTSLGLASCSEERAMACVAGHRILDAC
KHLVEGKNFHLGTLLPLIGTSDKVKREMREQLKAWHDSKMLSEFSDSIRAIYELLGGNACVCEGMKAVPIEDRMD
SFVIAKKFGLDWRQSFGLRLWYAINEGDGAAAAVKMFEEDLSQDKEEAPRPWFIDEGFLPQWNDAHAEDRQDLLW
GLLRLYADEQVDLEAVLRPENSQLSPFNMRLCWQLGVALVSTGKVSFGKDGAEKADAATVAYATQLTAAGEWLDA
VFVLLHLSDAKARAKAIQEHLCRHAGLIGAESEANFTKLVDKYRVPATWIWEAKALYIRSVERDASGEVHCLLRA
GSFAEAHRVLVQQVAPRAIIERDYAALSALVDQMKEKRDSISGWALGGQVYSNFLSLMQHRERAESVAPSLLEKM
MGGLRAMSEAVGEAEIERYAAVSDMADETAREILKLSKKKQDTELRARILGLPLTQDRLLAYSLDMAYSVDTGFA
VRA*
Coding >Ophcf2|01154
ATGTCCTTTGGTAGCAGCGGCTTCGGGGGCTTCGGCTCAAACAACAACCAGACGTCGAGCGGCTTCGGGAGTGGC
TTCGGCTCGAACAACAATAATTCGGGCACGGGCTTCGGATCCAATACTGGTGGCGGTTTTGGCCAGAGTACGAAC
ACGGGAGGCGGCGTGTTTGGCAACGCCACTCAATCTGGCTTTGGCTCTCCTTCGGGAGGCTTCGGCTCCAACGCC
GGGGGCGGCTTCGGAAGTAAGCCTGCTTTTGGGTCCAGCAACACTGCCGGCGGCGGCTTGTTTGGAGCTTCCAAC
GCCAATAATACCACCAGCAACTCGGGCTTCGGCGGCTTTGGCAGTACCAACAATGCCAACTCGTCTCCCTTTGGC
GGCGGAAATACGACTGGAGGAGGCCTCTTCGGGAACAGCGCCAACAAGACAGGCTTTGGTGCCGCAGCCAATACC
GGTTCATCTCTCTTCGGCGCTACCAATACCAGCTCCGGCGGCGGCTTTGGTGGCAGCGGATTTGGCGCTGCGAGC
AACCCCGCGGCTGCAGTCGGTGATCCTCCCGGCACGGGTGCGACGCCATTTACCGCCTTTGTCGAAAAGGAGCCC
AACAGTACGAACCAGTCGAATTCGTTCCAGAATATCCTCTTCCAGGATCCCTACAGGAAATGGTCTGCTGAGGAG
CTACGACTGGCTGACTACGTCCAAGGACGCCGCCATGGCAATGCGAACGGAGCGGGCGCGTTCGGTGTGAATTCT
GGCTTCGGGGGCGGCTTTGGCTCCAACAACAATCAGACGACGAATGCATTTGGCACACCTTCAAACGCCGGCGGC
GGACTCTTTGGGGCCGGCAACGCCAGCACGAACAACAATGCCGGGGGCTTCGGACAGGCTGCAGCTGGAGCTTTC
GGTGCCAACAGTGGCAACGCCTCGGGCGGCCTGTTCGGCAATAGCAACAAGCCCAGTGGCGGTCTTTTTGGGAAT
CCCACGACTCAGCAGAGCAGCGGCCTCTTCGGCTCGGGAACTGGAGGAGGGTTCGGCGCGAACAACAACAACAAC
ACCAGCGCCTTTGGCGGCACCGCCAATACTGCAGGTGGGCTCTTCGGCTCCAGCAACCAGGCCAATAAGCCCCAG
GGGACTGGGTTCAGCTTCGGAAATGCCAATGCCAATAATACCACGTCTGCGTTTGGCGGCTCCAACACGGGAGGC
GCTTTCGGCACGGCAAACTCTGGAAACTCCGGCCTCTTTGGGGCCTCCAACAACCAGCAGTCCAGCGGCGGACTT
TTTGGCAATGCCCAGCAACAGCAGCAGCCCAATACCAACTCACCTTTCGGTTCCGGCTTCGGCGCACAGAACCAG
AGCCAAAACCCGCAGGGTCTCTTTGGGAATGCGCAGCAGAAACCGGCATCGAGCGGCCTCTTCGGCGCGGCCACT
ACCACCACCACTCCCACCAATAGCCTCTTCGGCAGTGCCAACAATCAACAGCAAGGCACGAGCGCCTTTGGTACC
AACAACACAGCGGCAACTGGCGGTCTCTTCGGCGCCCCCAAGCCCAGCGCCACGACCAGTCTCTTTGGCGCGCCC
AATGCGAACCAGGCCAATTCCACCGGCACTGGTCTGTTTGGAGCCTTGGGATCCAACAATCAGGCTCAACCGACG
ACTGGAAGCTCGTTGTTTGGAACGGCGAACAACACGCAGCAGAAACCCGGCGGCCTGTTCGGCACCACCAACCAA
GCGTCAGGCTCAAGTCTCTTCGGGGGAACAAACAACCAGGTCCAGGGCAACTCGCTGTTTGGCAACGGTGCAAAT
CAGCAGCAGACGCAGTCCTCGGGCTTCGGCGGCTCCTTGCTGGGGGGCACTCAGCAACTGGGCAACGCGCCCCAG
GGTCTCACGGCAAACCTCAACGACGTCTCGGCCTATGGCAGCCCCTCGCTGTTCGCCGGCCTCAGCGGTAATGAG
GTCTCCAACCCCGGTCCTCTCGCCACGCCTCTAAATAGCAGCTCGAAGCCGCGCCGGAGCTCTATCCTTCCCATG
TACAAGCTGGCCCCTTCGACCGCATCGCGATTTGCCACCCCTCAGAAGCGGGGGTTTGGTTTCTCATACAGCTCG
TTCGGAACGCCGGGAGCCAGTCCCGCCGGCAGCATCTCCAGCACGCCTGGCGGTCTCGGCCGAAGTCTGCTTGGT
CCCGGAGGCAGCGGGACGCTTTCTAAGAGCATGTCGACCAACAACCTTCGCCGCAGCTTCGCAGCTGAGGACAGC
ATCCTCGCGCCCGGTGCTTTCTCGTCTAGCTCTAACGGCCATTGGTATGGGAGCACTGGATCCAAGAAGCTCGTC
ATCAACAGGGACATCAGGAGCGATCTTTTTTCCTCCCCTCAGCGCGACAAGCAGTCTGTGGACGGGGCCGCCAGC
GCCCGCAAGCTCTCGAAGCGTGTCAGCTTCGACACCAGCAACGTCGAAGACGAGAACGGGACGCCGCCGCGCAAC
GCGCTTCCCGCTTCTGAGGACACGCCAAGCTCTGAGACACAGGACTCGACTCCTCGCCAGAACAGGAGCCTGACT
GCTGCCAACGGCATGAAAACTCCGGACATGGAGCACGTCAAGGGGAACGAGTTGGCGATCGTGCATGAGGAGGAC
CACACCGCCACGCCTGAGTCGCCGGACACGCCCAGCCGGGATCGAGCTCCAGGACAGTACTGGATGAACCCGGAC
AAGGAAGGATTTTTCAACATGAACAGGATGCAGCGACAAAGGATCGCTGGCTTCTCTGTCGGCCGCGAAAACGTC
GGTCACATCACGTTCAAGTTGCCCGTGGACATTAGCGGCATCAACATCGATGACATCTGCGGCACCATCGTAGTG
CTCGAGCCTCGATCCGCTACCGTGTACCCCAACCAAGCCAAGAAGCCGCCTGTCGGCCGGGGACTCAATGTGCCG
GCCACGATCCTGCTGGAACAGTCCTGGCCGCGTGGAGGCCGTCAGAGGCGCTCGTCGGGCGATTTCAAGCGATTC
AGCAGACATGTGGAGCGACTTCGCGAGATCCCCGACACTACTTTTGAGAGTTTTGACGAGAGCACCGGCACATGG
GTCTTTTCTGTGGAACACTTTACCACTTATGGTCTAAAAGATGAATCGGATTATGAGTCGGACGAGGATGATGAA
GGAGACCTAGTCATGACAGCACCCACGGCTCGCTCTCGCGTCGTGTCCGAGTCCTCGGTCAATCCGGCCTCGGGA
GGCGAGTCATTCAGCTCCTCCCACAGCAGGGATCTGCCGGGTGCTTTTGATGGACGGATGGAGCCTCTCGACGGA
AACGACGCCGCGAAGCCGTCTTTTTTTGGGAATAGCTCCGCGGATCTGACGTCCAACAATGTGCAGTTGTCTCTG
GAAGAGTACGACACCCACATGGACGACGGATATGACGTGTCTGAGGACGAAGACGTAGCGAGGTCTTCTGTCGGA
CACCATCGTGCCGCGGAGCAGGAAGACTCCTCGCCAGAAGCCGATCAGGAGCCCAGGAGGGCAACACCCGGCGGC
ATCCTCAGAGCCAGGATGCGGGCCATGAAAGACTCCATTGGTCCAGTGCGGCTCGAGGTTCCCGATGGCGACGAC
TGGATGAGCATGCTCATGAAGACGGTCAGCCCCGCCAAGCGAGACCGTCAGCAGCTCCGGGAGCAAAACGAGACC
CCTTCCAAGCGTCGATGCGTCGGCAACCCCGTCGGCCTCGATGAAGACGACGAAGTTTTTGGAACATCATCGATG
CTGGATCGAAGCCCCAGCAAGGCGGGCCAGGCGTCGGCTGCGATGACCAAGCTTGCGATGGATAAGGGCCAGGGG
TTCGCCACCAGCATCGATCTGATGAATTCATTGTTTGACAAGTCGAGGTTCGCGAAGACTCCCGTCGCCTCAACG
CCGAAAAAGGGGCTTCCGGAGTGGCCCTATGAACGCCAAGACAAGAGTTGGGTCGTCGGCGAAGCTGAGCAATCG
TATCACAACGCGTCACGTCCAACCTGGGGCCCTGGGGAAGTATTGGTAGTGACGCGTTCGCTGGAAACTGCGCAA
TCGTTTCGCAACGGCTCCAATATCCTAGCTTTCCAGTTGTCGGGTATTCAAACGCAGCTGCAAGATGTCAGGCTT
GCCAAGTTCTCCATCACGTCTTCGCAGACGCTTCTGCTCGCCCAGCAAGGGATGACCGAGATTGGTCTCATCGAC
GGCGTTCCAATGGCTACGCTTCATGTGGCGCGCCTGCGGGACCTCTTTCACCATCAGGACGTGCAGAGCGCTGCC
AACGTGCACGAGAAGCATGTCTGGGAGCTGTCGAGCATCCTCTTTGACCGATTGGCTCCTTCGGACGCGTCCGAC
GGAAACGAAGATTCGACAAGAAAGACGATGTTGTCCAAGTTCTGGACCGACCTGGTGGAGCAGGCGTCGACGACT
AGTCTCGGTCTCGCAAGTTGCAGCGAAGAAAGGGCCATGGCATGCGTGGCAGGACATCGGATCTTGGACGCGTGC
AAGCACCTTGTGGAAGGCAAAAACTTCCACCTCGGCACCCTCTTGCCGCTGATAGGCACCAGCGACAAGGTCAAA
CGGGAGATGAGAGAGCAACTCAAGGCGTGGCATGACTCCAAGATGCTGTCCGAGTTCTCGGACTCGATTCGGGCA
ATTTACGAGCTTCTGGGGGGTAACGCTTGCGTCTGCGAAGGCATGAAGGCCGTCCCGATCGAGGACCGGATGGAC
TCGTTTGTCATTGCGAAGAAGTTTGGGCTGGACTGGCGGCAGTCGTTTGGCTTACGGTTGTGGTACGCCATCAAC
GAAGGGGACGGTGCGGCTGCTGCGGTCAAGATGTTTGAGGAGGACTTAAGCCAGGACAAGGAGGAAGCGCCACGA
CCGTGGTTCATCGACGAGGGTTTCTTGCCGCAATGGAACGATGCGCACGCTGAAGATCGCCAGGATCTTCTGTGG
GGGCTCCTACGTCTGTACGCCGACGAGCAGGTCGACCTTGAGGCCGTGCTTCGACCGGAGAACTCGCAATTGTCT
CCCTTCAACATGCGGCTCTGTTGGCAGCTGGGCGTGGCCTTGGTGTCCACCGGCAAGGTCTCATTCGGTAAAGAT
GGAGCGGAGAAGGCGGACGCGGCGACGGTGGCGTACGCGACGCAGCTCACGGCAGCCGGCGAGTGGCTCGATGCC
GTCTTCGTTCTGCTGCACCTGAGCGACGCCAAGGCTCGAGCCAAGGCGATACAGGAGCATCTCTGTCGACACGCG
GGACTGATAGGAGCCGAGTCCGAGGCCAACTTTACGAAGCTGGTCGACAAGTATCGCGTCCCCGCGACATGGATT
TGGGAGGCGAAGGCCTTGTATATTCGCAGCGTGGAGCGCGACGCGTCGGGCGAGGTGCACTGCCTCCTGCGAGCC
GGGTCGTTTGCGGAGGCGCATCGGGTGCTGGTTCAGCAAGTGGCGCCGCGGGCCATTATCGAACGCGATTATGCC
GCTCTGTCGGCATTGGTGGATCAGATGAAGGAGAAACGGGACTCGATTTCCGGATGGGCCTTGGGCGGGCAGGTT
TACAGCAACTTCCTCAGCCTGATGCAGCATCGCGAGCGGGCCGAGAGCGTCGCGCCGTCGCTGCTGGAGAAGATG
ATGGGCGGCCTCAGGGCGATGAGCGAGGCTGTGGGCGAGGCCGAGATTGAGCGGTACGCGGCCGTGTCGGACATG
GCGGACGAGACGGCGCGGGAGATATTGAAACTGAGCAAGAAGAAGCAGGACACTGAGCTTCGGGCTCGGATTCTG
GGCCTCCCTCTAACGCAAGATCGGCTGCTAGCCTACTCGTTGGACATGGCCTATTCGGTAGACACGGGCTTCGCC
GTCCGTGCCTAG
Transcript >Ophcf2|01154
ATGTCCTTTGGTAGCAGCGGCTTCGGGGGCTTCGGCTCAAACAACAACCAGACGTCGAGCGGCTTCGGGAGTGGC
TTCGGCTCGAACAACAATAATTCGGGCACGGGCTTCGGATCCAATACTGGTGGCGGTTTTGGCCAGAGTACGAAC
ACGGGAGGCGGCGTGTTTGGCAACGCCACTCAATCTGGCTTTGGCTCTCCTTCGGGAGGCTTCGGCTCCAACGCC
GGGGGCGGCTTCGGAAGTAAGCCTGCTTTTGGGTCCAGCAACACTGCCGGCGGCGGCTTGTTTGGAGCTTCCAAC
GCCAATAATACCACCAGCAACTCGGGCTTCGGCGGCTTTGGCAGTACCAACAATGCCAACTCGTCTCCCTTTGGC
GGCGGAAATACGACTGGAGGAGGCCTCTTCGGGAACAGCGCCAACAAGACAGGCTTTGGTGCCGCAGCCAATACC
GGTTCATCTCTCTTCGGCGCTACCAATACCAGCTCCGGCGGCGGCTTTGGTGGCAGCGGATTTGGCGCTGCGAGC
AACCCCGCGGCTGCAGTCGGTGATCCTCCCGGCACGGGTGCGACGCCATTTACCGCCTTTGTCGAAAAGGAGCCC
AACAGTACGAACCAGTCGAATTCGTTCCAGAATATCCTCTTCCAGGATCCCTACAGGAAATGGTCTGCTGAGGAG
CTACGACTGGCTGACTACGTCCAAGGACGCCGCCATGGCAATGCGAACGGAGCGGGCGCGTTCGGTGTGAATTCT
GGCTTCGGGGGCGGCTTTGGCTCCAACAACAATCAGACGACGAATGCATTTGGCACACCTTCAAACGCCGGCGGC
GGACTCTTTGGGGCCGGCAACGCCAGCACGAACAACAATGCCGGGGGCTTCGGACAGGCTGCAGCTGGAGCTTTC
GGTGCCAACAGTGGCAACGCCTCGGGCGGCCTGTTCGGCAATAGCAACAAGCCCAGTGGCGGTCTTTTTGGGAAT
CCCACGACTCAGCAGAGCAGCGGCCTCTTCGGCTCGGGAACTGGAGGAGGGTTCGGCGCGAACAACAACAACAAC
ACCAGCGCCTTTGGCGGCACCGCCAATACTGCAGGTGGGCTCTTCGGCTCCAGCAACCAGGCCAATAAGCCCCAG
GGGACTGGGTTCAGCTTCGGAAATGCCAATGCCAATAATACCACGTCTGCGTTTGGCGGCTCCAACACGGGAGGC
GCTTTCGGCACGGCAAACTCTGGAAACTCCGGCCTCTTTGGGGCCTCCAACAACCAGCAGTCCAGCGGCGGACTT
TTTGGCAATGCCCAGCAACAGCAGCAGCCCAATACCAACTCACCTTTCGGTTCCGGCTTCGGCGCACAGAACCAG
AGCCAAAACCCGCAGGGTCTCTTTGGGAATGCGCAGCAGAAACCGGCATCGAGCGGCCTCTTCGGCGCGGCCACT
ACCACCACCACTCCCACCAATAGCCTCTTCGGCAGTGCCAACAATCAACAGCAAGGCACGAGCGCCTTTGGTACC
AACAACACAGCGGCAACTGGCGGTCTCTTCGGCGCCCCCAAGCCCAGCGCCACGACCAGTCTCTTTGGCGCGCCC
AATGCGAACCAGGCCAATTCCACCGGCACTGGTCTGTTTGGAGCCTTGGGATCCAACAATCAGGCTCAACCGACG
ACTGGAAGCTCGTTGTTTGGAACGGCGAACAACACGCAGCAGAAACCCGGCGGCCTGTTCGGCACCACCAACCAA
GCGTCAGGCTCAAGTCTCTTCGGGGGAACAAACAACCAGGTCCAGGGCAACTCGCTGTTTGGCAACGGTGCAAAT
CAGCAGCAGACGCAGTCCTCGGGCTTCGGCGGCTCCTTGCTGGGGGGCACTCAGCAACTGGGCAACGCGCCCCAG
GGTCTCACGGCAAACCTCAACGACGTCTCGGCCTATGGCAGCCCCTCGCTGTTCGCCGGCCTCAGCGGTAATGAG
GTCTCCAACCCCGGTCCTCTCGCCACGCCTCTAAATAGCAGCTCGAAGCCGCGCCGGAGCTCTATCCTTCCCATG
TACAAGCTGGCCCCTTCGACCGCATCGCGATTTGCCACCCCTCAGAAGCGGGGGTTTGGTTTCTCATACAGCTCG
TTCGGAACGCCGGGAGCCAGTCCCGCCGGCAGCATCTCCAGCACGCCTGGCGGTCTCGGCCGAAGTCTGCTTGGT
CCCGGAGGCAGCGGGACGCTTTCTAAGAGCATGTCGACCAACAACCTTCGCCGCAGCTTCGCAGCTGAGGACAGC
ATCCTCGCGCCCGGTGCTTTCTCGTCTAGCTCTAACGGCCATTGGTATGGGAGCACTGGATCCAAGAAGCTCGTC
ATCAACAGGGACATCAGGAGCGATCTTTTTTCCTCCCCTCAGCGCGACAAGCAGTCTGTGGACGGGGCCGCCAGC
GCCCGCAAGCTCTCGAAGCGTGTCAGCTTCGACACCAGCAACGTCGAAGACGAGAACGGGACGCCGCCGCGCAAC
GCGCTTCCCGCTTCTGAGGACACGCCAAGCTCTGAGACACAGGACTCGACTCCTCGCCAGAACAGGAGCCTGACT
GCTGCCAACGGCATGAAAACTCCGGACATGGAGCACGTCAAGGGGAACGAGTTGGCGATCGTGCATGAGGAGGAC
CACACCGCCACGCCTGAGTCGCCGGACACGCCCAGCCGGGATCGAGCTCCAGGACAGTACTGGATGAACCCGGAC
AAGGAAGGATTTTTCAACATGAACAGGATGCAGCGACAAAGGATCGCTGGCTTCTCTGTCGGCCGCGAAAACGTC
GGTCACATCACGTTCAAGTTGCCCGTGGACATTAGCGGCATCAACATCGATGACATCTGCGGCACCATCGTAGTG
CTCGAGCCTCGATCCGCTACCGTGTACCCCAACCAAGCCAAGAAGCCGCCTGTCGGCCGGGGACTCAATGTGCCG
GCCACGATCCTGCTGGAACAGTCCTGGCCGCGTGGAGGCCGTCAGAGGCGCTCGTCGGGCGATTTCAAGCGATTC
AGCAGACATGTGGAGCGACTTCGCGAGATCCCCGACACTACTTTTGAGAGTTTTGACGAGAGCACCGGCACATGG
GTCTTTTCTGTGGAACACTTTACCACTTATGGTCTAAAAGATGAATCGGATTATGAGTCGGACGAGGATGATGAA
GGAGACCTAGTCATGACAGCACCCACGGCTCGCTCTCGCGTCGTGTCCGAGTCCTCGGTCAATCCGGCCTCGGGA
GGCGAGTCATTCAGCTCCTCCCACAGCAGGGATCTGCCGGGTGCTTTTGATGGACGGATGGAGCCTCTCGACGGA
AACGACGCCGCGAAGCCGTCTTTTTTTGGGAATAGCTCCGCGGATCTGACGTCCAACAATGTGCAGTTGTCTCTG
GAAGAGTACGACACCCACATGGACGACGGATATGACGTGTCTGAGGACGAAGACGTAGCGAGGTCTTCTGTCGGA
CACCATCGTGCCGCGGAGCAGGAAGACTCCTCGCCAGAAGCCGATCAGGAGCCCAGGAGGGCAACACCCGGCGGC
ATCCTCAGAGCCAGGATGCGGGCCATGAAAGACTCCATTGGTCCAGTGCGGCTCGAGGTTCCCGATGGCGACGAC
TGGATGAGCATGCTCATGAAGACGGTCAGCCCCGCCAAGCGAGACCGTCAGCAGCTCCGGGAGCAAAACGAGACC
CCTTCCAAGCGTCGATGCGTCGGCAACCCCGTCGGCCTCGATGAAGACGACGAAGTTTTTGGAACATCATCGATG
CTGGATCGAAGCCCCAGCAAGGCGGGCCAGGCGTCGGCTGCGATGACCAAGCTTGCGATGGATAAGGGCCAGGGG
TTCGCCACCAGCATCGATCTGATGAATTCATTGTTTGACAAGTCGAGGTTCGCGAAGACTCCCGTCGCCTCAACG
CCGAAAAAGGGGCTTCCGGAGTGGCCCTATGAACGCCAAGACAAGAGTTGGGTCGTCGGCGAAGCTGAGCAATCG
TATCACAACGCGTCACGTCCAACCTGGGGCCCTGGGGAAGTATTGGTAGTGACGCGTTCGCTGGAAACTGCGCAA
TCGTTTCGCAACGGCTCCAATATCCTAGCTTTCCAGTTGTCGGGTATTCAAACGCAGCTGCAAGATGTCAGGCTT
GCCAAGTTCTCCATCACGTCTTCGCAGACGCTTCTGCTCGCCCAGCAAGGGATGACCGAGATTGGTCTCATCGAC
GGCGTTCCAATGGCTACGCTTCATGTGGCGCGCCTGCGGGACCTCTTTCACCATCAGGACGTGCAGAGCGCTGCC
AACGTGCACGAGAAGCATGTCTGGGAGCTGTCGAGCATCCTCTTTGACCGATTGGCTCCTTCGGACGCGTCCGAC
GGAAACGAAGATTCGACAAGAAAGACGATGTTGTCCAAGTTCTGGACCGACCTGGTGGAGCAGGCGTCGACGACT
AGTCTCGGTCTCGCAAGTTGCAGCGAAGAAAGGGCCATGGCATGCGTGGCAGGACATCGGATCTTGGACGCGTGC
AAGCACCTTGTGGAAGGCAAAAACTTCCACCTCGGCACCCTCTTGCCGCTGATAGGCACCAGCGACAAGGTCAAA
CGGGAGATGAGAGAGCAACTCAAGGCGTGGCATGACTCCAAGATGCTGTCCGAGTTCTCGGACTCGATTCGGGCA
ATTTACGAGCTTCTGGGGGGTAACGCTTGCGTCTGCGAAGGCATGAAGGCCGTCCCGATCGAGGACCGGATGGAC
TCGTTTGTCATTGCGAAGAAGTTTGGGCTGGACTGGCGGCAGTCGTTTGGCTTACGGTTGTGGTACGCCATCAAC
GAAGGGGACGGTGCGGCTGCTGCGGTCAAGATGTTTGAGGAGGACTTAAGCCAGGACAAGGAGGAAGCGCCACGA
CCGTGGTTCATCGACGAGGGTTTCTTGCCGCAATGGAACGATGCGCACGCTGAAGATCGCCAGGATCTTCTGTGG
GGGCTCCTACGTCTGTACGCCGACGAGCAGGTCGACCTTGAGGCCGTGCTTCGACCGGAGAACTCGCAATTGTCT
CCCTTCAACATGCGGCTCTGTTGGCAGCTGGGCGTGGCCTTGGTGTCCACCGGCAAGGTCTCATTCGGTAAAGAT
GGAGCGGAGAAGGCGGACGCGGCGACGGTGGCGTACGCGACGCAGCTCACGGCAGCCGGCGAGTGGCTCGATGCC
GTCTTCGTTCTGCTGCACCTGAGCGACGCCAAGGCTCGAGCCAAGGCGATACAGGAGCATCTCTGTCGACACGCG
GGACTGATAGGAGCCGAGTCCGAGGCCAACTTTACGAAGCTGGTCGACAAGTATCGCGTCCCCGCGACATGGATT
TGGGAGGCGAAGGCCTTGTATATTCGCAGCGTGGAGCGCGACGCGTCGGGCGAGGTGCACTGCCTCCTGCGAGCC
GGGTCGTTTGCGGAGGCGCATCGGGTGCTGGTTCAGCAAGTGGCGCCGCGGGCCATTATCGAACGCGATTATGCC
GCTCTGTCGGCATTGGTGGATCAGATGAAGGAGAAACGGGACTCGATTTCCGGATGGGCCTTGGGCGGGCAGGTT
TACAGCAACTTCCTCAGCCTGATGCAGCATCGCGAGCGGGCCGAGAGCGTCGCGCCGTCGCTGCTGGAGAAGATG
ATGGGCGGCCTCAGGGCGATGAGCGAGGCTGTGGGCGAGGCCGAGATTGAGCGGTACGCGGCCGTGTCGGACATG
GCGGACGAGACGGCGCGGGAGATATTGAAACTGAGCAAGAAGAAGCAGGACACTGAGCTTCGGGCTCGGATTCTG
GGCCTCCCTCTAACGCAAGATCGGCTGCTAGCCTACTCGTTGGACATGGCCTATTCGGTAGACACGGGCTTCGCC
GTCCGTGCCTAG
Gene >Ophcf2|01154
ATGTCCTTTGGTAGCAGCGGCTTCGGGGGCTTCGGCTCAAACAACAACCAGACGTCGAGCGGCTTCGGGAGTGGC
TTCGGCTCGAACAACAATAATTCGGGCACGGGTACGATTCCTCGGGCGCAAGTTACCCTCCCCATCCTGACACCG
GCTTTTTCAGGCTTCGGATCCAATACTGGTGGCGGTTTTGGCCAGAGTACGAACACGGGAGGCGGCGTGTTTGGC
AACGCCACTCAATCTGGCTTTGGCTCTCCTTCGGGTAAGGCTACTCTTCGTCCTCCTTCTCCCTGCTTTATCACC
GCCTGCATCTGCAAATCGCTAACCCCGTGGGCCCCAGGAGGCTTCGGCTCCAACGCCGGGGGCGGCTTCGGAAGT
AAGCCTGCTTTTGGGTCCAGCAACACTGCCGGCGGCGGCTTGTTTGGAGCTTCCAACGCCAATAATACCACCAGC
AACTCGGGCTTCGGCGGCTTTGGCAGTACCAACAATGCCAACTCGTCTCCCTTTGGCGGCGGAAATACGACTGGA
GGAGGCCTCTTCGGGAACAGCGCCAACAAGACAGGCTTTGGTGCCGCAGCCAATACCGGTTCATCTCTCTTCGGC
GCTACCAATACCAGCTCCGGCGGCGGCTTTGGTGGCAGCGGATTTGGCGCTGCGAGCAACCCCGCGGCTGCAGTC
GGTGATCCTCCCGGCACGGGTGCGACGCCATTTACCGCCTTTGTCGAAAAGGAGCCCAACAGTACGAACCAGTCG
AATTCGTTCCAGAATATCCTCTTCCAGGATCCCTACAGGAAATGGTCTGCTGAGGAGCTACGACTGGCTGACTAC
GTCCAAGGACGCCGCCATGGCAATGCGAACGGAGCGGGCGCGTTCGGTGTGAATTCTGGCTTCGGGGGCGGCTTT
GGCTCCAACAACAATCAGACGACGAATGCATTTGGCACACCTTCAAACGCCGGCGGCGGACTCTTTGGGGCCGGC
AACGCCAGCACGAACAACAATGCCGGGGGCTTCGGACAGGCTGCAGCTGGAGCTTTCGGTGCCAACAGTGGCAAC
GCCTCGGGCGGCCTGTTCGGCAATAGCAACAAGCCCAGTGGCGGTCTTTTTGGGAATCCCACGACTCAGCAGAGC
AGCGGCCTCTTCGGCTCGGGAACTGGAGGAGGGTTCGGCGCGAACAACAACAACAACACCAGCGCCTTTGGCGGC
ACCGCCAATACTGCAGGTGGGCTCTTCGGCTCCAGCAACCAGGCCAATAAGCCCCAGGGGACTGGGTTCAGCTTC
GGAAATGCCAATGCCAATAATACCACGTCTGCGTTTGGCGGCTCCAACACGGGAGGCGCTTTCGGCACGGCAAAC
TCTGGAAACTCCGGCCTCTTTGGGGCCTCCAACAACCAGCAGTCCAGCGGCGGACTTTTTGGCAATGCCCAGCAA
CAGCAGCAGCCCAATACCAACTCACCTTTCGGTTCCGGCTTCGGCGCACAGAACCAGAGCCAAAACCCGCAGGGT
CTCTTTGGGAATGCGCAGCAGAAACCGGCATCGAGCGGCCTCTTCGGCGCGGCCACTACCACCACCACTCCCACC
AATAGCCTCTTCGGCAGTGCCAACAATCAACAGCAAGGCACGAGCGCCTTTGGTACCAACAACACAGCGGCAACT
GGCGGTCTCTTCGGCGCCCCCAAGCCCAGCGCCACGACCAGTCTCTTTGGCGCGCCCAATGCGAACCAGGCCAAT
TCCACCGGCACTGGTCTGTTTGGAGCCTTGGGATCCAACAATCAGGCTCAACCGACGACTGGAAGCTCGTTGTTT
GGAACGGCGAACAACACGCAGCAGAAACCCGGCGGCCTGTTCGGCACCACCAACCAAGCGTCAGGCTCAAGTCTC
TTCGGGGGAACAAACAACCAGGTCCAGGGCAACTCGCTGTTTGGCAACGGTGCAAATCAGCAGCAGACGCAGTCC
TCGGGCTTCGGCGGCTCCTTGCTGGGGGGCACTCAGCAACTGGGCAACGCGCCCCAGGGTCTCACGGCAAACCTC
AACGACGTCTCGGCCTATGGCAGCCCCTCGCTGTTCGCCGGCCTCAGCGGTAATGAGGTCTCCAACCCCGGTCCT
CTCGCCACGCCTCTAAATAGCAGCTCGAAGCCGCGCCGGAGCTCTATCCTTCCCATGTACAAGCTGGCCCCTTCG
ACCGCATCGCGATTTGCCACCCCTCAGAAGCGGGGGTTTGGTTTCTCATACAGCTCGTTCGGAACGCCGGGAGCC
AGTCCCGCCGGCAGCATCTCCAGCACGCCTGGCGGTCTCGGCCGAAGTCTGCTTGGTCCCGGAGGCAGCGGGACG
CTTTCTAAGAGCATGTCGACCAACAACCTTCGCCGCAGCTTCGCAGCTGAGGACAGCATCCTCGCGCCCGGTGCT
TTCTCGTCTAGCTCTAACGGCCATTGGTATGGGAGCACTGGATCCAAGAAGCTCGTCATCAACAGGGACATCAGG
AGCGATCTTTTTTCCTCCCCTCAGCGCGACAAGCAGTCTGTGGACGGGGCCGCCAGCGCCCGCAAGCTCTCGAAG
CGTGTCAGCTTCGACACCAGCAACGTCGAAGACGAGAACGGGACGCCGCCGCGCAACGCGCTTCCCGCTTCTGAG
GACACGCCAAGCTCTGAGACACAGGACTCGACTCCTCGCCAGAACAGGAGCCTGACTGCTGCCAACGGCATGAAA
ACTCCGGACATGGAGCACGTCAAGGGGAACGAGTTGGCGATCGTGCATGAGGAGGACCACACCGCCACGCCTGAG
TCGCCGGACACGCCCAGCCGGGATCGAGCTCCAGGACAGTACTGGATGAACCCGGACAAGGAAGGATTTTTCAAC
ATGAACAGGATGCAGCGACAAAGGATCGCTGGCTTCTCTGTCGGCCGCGAAAACGTCGGTCACATCACGTTCAAG
TTGCCCGTGGACATTAGCGGCATCAACATCGATGACATCTGCGGCACCATCGTAGTGCTCGAGCCTCGATCCGCT
ACCGTGTACCCCAACCAAGCCAAGAAGCCGCCTGTCGGCCGGGGACTCAATGTGCCGGCCACGATCCTGCTGGAA
CAGTCCTGGCCGCGTGGAGGCCGTCAGAGGCGCTCGTCGGGCGATTTCAAGCGATTCAGCAGACATGTGGAGCGA
CTTCGCGAGATCCCCGACACTACTTTTGAGAGTTTTGACGAGAGCACCGGCACATGGGTCTTTTCTGTGGAACAC
TTTACCACTTATGGTCTAAAAGATGAATCGGATTATGAGTCGGACGAGGATGATGAAGGAGACCTAGTCATGACA
GCACCCACGGCTCGCTCTCGCGTCGTGTCCGAGTCCTCGGTCAATCCGGCCTCGGGAGGCGAGTCATTCAGCTCC
TCCCACAGCAGGGATCTGCCGGGTGCTTTTGATGGACGGATGGAGCCTCTCGACGGAAACGACGCCGCGAAGCCG
TCTTTTTTTGGGAATAGCTCCGCGGATCTGACGTCCAACAATGTGCAGTTGTCTCTGGAAGAGTACGACACCCAC
ATGGACGACGGATATGACGTGTCTGAGGACGAAGACGTAGCGAGGTCTTCTGTCGGACACCATCGTGCCGCGGAG
CAGGAAGACTCCTCGCCAGAAGCCGATCAGGAGCCCAGGAGGGCAACACCCGGCGGCATCCTCAGAGCCAGGATG
CGGGCCATGAAAGACTCCATTGGTCCAGTGCGGCTCGAGGTTCCCGATGGCGACGACTGGATGAGCATGCTCATG
AAGACGGTCAGCCCCGCCAAGCGAGACCGTCAGCAGCTCCGGGAGCAAAACGAGACCCCTTCCAAGCGTCGATGC
GTCGGCAACCCCGTCGGCCTCGATGAAGACGACGAAGTTTTTGGAACATCATCGATGCTGGATCGAAGCCCCAGC
AAGGCGGGCCAGGCGTCGGCTGCGATGACCAAGCTTGCGATGGATAAGGGCCAGGGGTTCGCCACCAGCATCGAT
CTGATGAATTCATTGTTTGACAAGTCGAGGTTCGCGAAGACTCCCGTCGCCTCAACGCCGAAAAAGGGGCTTCCG
GAGGTAAGTCGATCAGTTGGCGGCGAAGGGCTTGGACTGGATGCTGACATGGTCTCTCAGTGGCCCTATGAACGC
CAAGACAAGAGTTGGGTCGTCGGCGAAGCTGAGCAATCGTATCACAACGCGTCACGTCCAACCTGGGGCCCTGGG
GAAGTATTGGTAGTGACGCGTTCGCTGGAAACTGCGCAATCGTTTCGCAACGGCTCCAATATCCTAGCTTTCCAG
TTGTCGGGTATTCAAACGCAGCTGCAAGATGTCAGGCTTGCCAAGTTCTCCATCACGGTACGGCAGCCTCAGAAG
TCGTTTTACTCTTCATTTGCTAATCTTTTTTTTTTTCAGTCTTCGCAGACGCTTCTGCTCGCCCAGCAAGGGATG
ACCGAGATTGGTCTCATCGACGGCGTTCCAATGGCTACGCTTCATGTGGCGCGCCTGCGGGACCTCTTTCACCAT
CAGGACGTGCAGAGCGCTGCCAACGTGCACGAGAAGCATGTCTGGGAGCTGTCGAGCATCCTCTTTGACCGATTG
GCTCCTTCGGACGCGTCCGACGGAAACGAAGATTCGACAAGAAAGACGATGTTGTCCAAGTTCTGGACCGACCTG
GTGGAGCAGGCGTCGACGACTAGTCTCGGTCTCGCAAGTTGCAGCGAAGAAAGGGCCATGGCATGCGTGGCAGGA
CATCGGATCTTGGACGCGTGCAAGCACCTTGTGGAAGGCAAAAACTTCCACCTCGGCACCCTCTTGCCGCTGATA
GGCACCAGCGACAAGGTCAAACGGGAGATGAGAGAGCAACTCAAGGCGTGGCATGACTCCAAGATGCTGTCCGAG
TTCTCGGACTCGATTCGGGCAATTTACGAGCTTCTGGGGGGTAACGCTTGCGTCTGCGAAGGCATGAAGGCCGTC
CCGATCGAGGACCGGATGGACTCGTTTGTCATTGCGAAGAAGTTTGGGCTGGACTGGCGGCAGTCGTTTGGCTTA
CGGTTGTGGTACGCCATCAACGAAGGGGACGGTGCGGCTGCTGCGGTCAAGATGTTTGAGGAGGACTTAAGCCAG
GACAAGGAGGAAGCGCCACGACCGTGGTTCATCGACGAGGGTTTCTTGCCGCAATGGAACGATGCGCACGCTGAA
GATCGCCAGGATCTTCTGTGGGGGCTCCTACGTCTGTACGCCGACGAGCAGGTCGACCTTGAGGCCGTGCTTCGA
CCGGAGAACTCGCAATTGTCTCCCTTCAACATGCGGCTCTGTTGGCAGCTGGGCGTGGCCTTGGTGTCCACCGGC
AAGGTCTCATTCGGTAAAGATGGAGCGGAGAAGGCGGACGCGGCGACGGTGGCGTACGCGACGCAGCTCACGGCA
GCCGGCGAGTGGCTCGATGCCGTCTTCGTTCTGCTGCACCTGAGCGACGCCAAGGCTCGAGCCAAGGCGATACAG
GAGCATCTCTGTCGACACGCGGGACTGATAGGAGCCGAGTCCGAGGCCAACTTTACGAAGCTGGTCGACAAGTAT
CGCGTCCCCGCGACATGGATTTGGGAGGCGAAGGCCTTGTATATTCGCAGCGTGGAGCGCGACGCGTCGGGCGAG
GTGCACTGCCTCCTGCGAGCCGGGTCGTTTGCGGAGGCGCATCGGGTGCTGGTTCAGCAAGTGGCGCCGCGGGCC
ATTATCGAACGCGATTATGCCGCTCTGTCGGCATTGGTGGATCAGATGAAGGAGAAACGGGACTCGATTTCCGGA
TGGGCCTTGGGCGGGCAGGTTTACAGCAACTTCCTCAGCCTGATGCAGCATCGCGAGCGGGCCGAGAGCGTCGCG
CCGTCGCTGCTGGAGAAGATGATGGGCGGCCTCAGGGCGATGAGCGAGGCTGTGGGCGAGGCCGAGATTGAGCGG
TACGCGGCCGTGTCGGACATGGCGGACGAGACGGCGCGGGAGATATTGAAACTGAGCAAGAAGAAGCAGGTAAGC
AGTTCGCAGCATCGGTGACTTCCACGCTTGAGCTGACGGACGAATTACAGGACACTGAGCTTCGGGCTCGGATTC
TGGGCCTCCCTCTAACGCAAGATCGGCTGCTAGCCTACTCGTTGGACATGGCCTATTCGGTAGACACGGGCTTCG
CCGTCCGTGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail