Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01152
Gene name
Locationscaffold_01:4201904..4203071
Strand-
Gene length (bp)1167
Transcript length (bp)1167
Coding sequence length (bp)1167
Protein length (aa) 389

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01171 ATP_bind_3 PP-loop family 8.8E-19 54 233
PF16503 zn-ribbon_14 Zinc-ribbon 8.7E-17 356 386

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5008 0.5834 0.0172 0.0949 0.2848 0.0324 0.1887 0.1517 0.0995 0.0187

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5676
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6449
Ophiocordyceps australis map64 (Brazil) OphauB2|7036
Ophiocordyceps camponoti-floridani Ophcf2|01152 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|77
Ophiocordyceps kimflemingae Ophio5|6957
Ophiocordyceps subramaniannii Hirsu2|8305

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01152
MPPTPCVLCRDQRAVVKRPKNHEKVCRDCFIAAFENEVHHTITSSNLFCSGERVAIGASGGKDSTVLASVLKTLN
ERHEYGLDLVLLSVDEGIKGYRDDSLETVKRNAAQYEMPLQIVGYDELYGWTMDQVVETIGKKGNCTYCGVFRRQ
ALDRGAKLLDIKHVVTGHNADDVAETILMNLLRGDLPRLSRSTSIMTGNSASDVKRSKPLKYAYEKEIVLYAHHK
KLDYFSTECIYSPEAFRGTARSLIKSLEKVRPSAILDIVRSGEDMARLTPDKGQGDCDCGDDEGIGRGCSSANAS
TSRIMPQEVRRERLETEITSIGTCETDGSVKLPVRTRRQRNGERDVAPPAPLQTLGRCVKCGYMSSQEMCQACTL
LENLNKNRADIVL*
Coding >Ophcf2|01152
ATGCCCCCTACACCCTGCGTGCTTTGCCGAGACCAAAGAGCTGTCGTCAAGAGGCCAAAAAACCACGAAAAGGTC
TGCAGAGACTGCTTCATCGCGGCATTCGAAAACGAAGTCCACCACACCATCACCTCGTCCAACCTCTTCTGCTCT
GGTGAGCGAGTCGCCATCGGAGCCTCGGGCGGCAAGGACTCTACTGTCCTGGCTTCAGTCCTCAAGACACTCAAT
GAGCGGCACGAGTACGGGCTCGACCTGGTTCTTCTGAGCGTTGACGAGGGCATCAAAGGATATCGCGATGACTCC
CTCGAGACGGTCAAGCGGAATGCGGCGCAGTACGAGATGCCCTTGCAGATTGTCGGTTACGACGAGCTCTACGGC
TGGACCATGGATCAAGTCGTCGAGACGATAGGCAAAAAGGGAAACTGCACCTACTGTGGCGTCTTTCGGAGACAA
GCCCTCGATCGAGGTGCCAAGCTACTCGATATCAAGCATGTCGTCACTGGCCACAACGCAGACGACGTGGCCGAG
ACGATTCTCATGAACCTCCTTCGTGGCGATCTTCCCCGGCTGTCGCGGAGCACCAGCATCATGACTGGCAATTCA
GCCAGCGACGTCAAAAGAAGCAAACCTCTCAAGTACGCGTACGAAAAGGAAATCGTCTTGTACGCCCACCACAAG
AAACTGGACTACTTCAGCACCGAGTGCATATACAGCCCCGAGGCCTTTCGAGGAACTGCGAGGAGCCTCATCAAG
AGCCTGGAAAAGGTCCGGCCAAGCGCGATTCTCGACATTGTGAGGAGCGGCGAGGACATGGCGCGGCTAACACCA
GACAAGGGACAAGGGGACTGCGACTGTGGTGACGACGAGGGCATCGGGCGTGGCTGCTCGTCGGCAAACGCTAGC
ACCTCGAGAATCATGCCGCAAGAGGTTCGTCGGGAAAGACTCGAGACGGAAATTACCTCCATTGGGACATGCGAG
ACAGACGGGTCGGTCAAGCTGCCTGTGAGGACTCGGCGACAGAGAAATGGCGAAAGAGATGTCGCTCCTCCTGCG
CCGCTGCAGACGCTCGGCCGGTGTGTCAAGTGTGGTTACATGTCAAGTCAAGAGATGTGCCAGGCATGCACGCTT
TTGGAGAACTTGAATAAGAACAGGGCTGACATCGTCCTATGA
Transcript >Ophcf2|01152
ATGCCCCCTACACCCTGCGTGCTTTGCCGAGACCAAAGAGCTGTCGTCAAGAGGCCAAAAAACCACGAAAAGGTC
TGCAGAGACTGCTTCATCGCGGCATTCGAAAACGAAGTCCACCACACCATCACCTCGTCCAACCTCTTCTGCTCT
GGTGAGCGAGTCGCCATCGGAGCCTCGGGCGGCAAGGACTCTACTGTCCTGGCTTCAGTCCTCAAGACACTCAAT
GAGCGGCACGAGTACGGGCTCGACCTGGTTCTTCTGAGCGTTGACGAGGGCATCAAAGGATATCGCGATGACTCC
CTCGAGACGGTCAAGCGGAATGCGGCGCAGTACGAGATGCCCTTGCAGATTGTCGGTTACGACGAGCTCTACGGC
TGGACCATGGATCAAGTCGTCGAGACGATAGGCAAAAAGGGAAACTGCACCTACTGTGGCGTCTTTCGGAGACAA
GCCCTCGATCGAGGTGCCAAGCTACTCGATATCAAGCATGTCGTCACTGGCCACAACGCAGACGACGTGGCCGAG
ACGATTCTCATGAACCTCCTTCGTGGCGATCTTCCCCGGCTGTCGCGGAGCACCAGCATCATGACTGGCAATTCA
GCCAGCGACGTCAAAAGAAGCAAACCTCTCAAGTACGCGTACGAAAAGGAAATCGTCTTGTACGCCCACCACAAG
AAACTGGACTACTTCAGCACCGAGTGCATATACAGCCCCGAGGCCTTTCGAGGAACTGCGAGGAGCCTCATCAAG
AGCCTGGAAAAGGTCCGGCCAAGCGCGATTCTCGACATTGTGAGGAGCGGCGAGGACATGGCGCGGCTAACACCA
GACAAGGGACAAGGGGACTGCGACTGTGGTGACGACGAGGGCATCGGGCGTGGCTGCTCGTCGGCAAACGCTAGC
ACCTCGAGAATCATGCCGCAAGAGGTTCGTCGGGAAAGACTCGAGACGGAAATTACCTCCATTGGGACATGCGAG
ACAGACGGGTCGGTCAAGCTGCCTGTGAGGACTCGGCGACAGAGAAATGGCGAAAGAGATGTCGCTCCTCCTGCG
CCGCTGCAGACGCTCGGCCGGTGTGTCAAGTGTGGTTACATGTCAAGTCAAGAGATGTGCCAGGCATGCACGCTT
TTGGAGAACTTGAATAAGAACAGGGCTGACATCGTCCTATGA
Gene >Ophcf2|01152
ATGCCCCCTACACCCTGCGTGCTTTGCCGAGACCAAAGAGCTGTCGTCAAGAGGCCAAAAAACCACGAAAAGGTC
TGCAGAGACTGCTTCATCGCGGCATTCGAAAACGAAGTCCACCACACCATCACCTCGTCCAACCTCTTCTGCTCT
GGTGAGCGAGTCGCCATCGGAGCCTCGGGCGGCAAGGACTCTACTGTCCTGGCTTCAGTCCTCAAGACACTCAAT
GAGCGGCACGAGTACGGGCTCGACCTGGTTCTTCTGAGCGTTGACGAGGGCATCAAAGGATATCGCGATGACTCC
CTCGAGACGGTCAAGCGGAATGCGGCGCAGTACGAGATGCCCTTGCAGATTGTCGGTTACGACGAGCTCTACGGC
TGGACCATGGATCAAGTCGTCGAGACGATAGGCAAAAAGGGAAACTGCACCTACTGTGGCGTCTTTCGGAGACAA
GCCCTCGATCGAGGTGCCAAGCTACTCGATATCAAGCATGTCGTCACTGGCCACAACGCAGACGACGTGGCCGAG
ACGATTCTCATGAACCTCCTTCGTGGCGATCTTCCCCGGCTGTCGCGGAGCACCAGCATCATGACTGGCAATTCA
GCCAGCGACGTCAAAAGAAGCAAACCTCTCAAGTACGCGTACGAAAAGGAAATCGTCTTGTACGCCCACCACAAG
AAACTGGACTACTTCAGCACCGAGTGCATATACAGCCCCGAGGCCTTTCGAGGAACTGCGAGGAGCCTCATCAAG
AGCCTGGAAAAGGTCCGGCCAAGCGCGATTCTCGACATTGTGAGGAGCGGCGAGGACATGGCGCGGCTAACACCA
GACAAGGGACAAGGGGACTGCGACTGTGGTGACGACGAGGGCATCGGGCGTGGCTGCTCGTCGGCAAACGCTAGC
ACCTCGAGAATCATGCCGCAAGAGGTTCGTCGGGAAAGACTCGAGACGGAAATTACCTCCATTGGGACATGCGAG
ACAGACGGGTCGGTCAAGCTGCCTGTGAGGACTCGGCGACAGAGAAATGGCGAAAGAGATGTCGCTCCTCCTGCG
CCGCTGCAGACGCTCGGCCGGTGTGTCAAGTGTGGTTACATGTCAAGTCAAGAGATGTGCCAGGCATGCACGCTT
TTGGAGAACTTGAATAAGAACAGGGCTGACATCGTCCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail