Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01150
Gene name
Locationscaffold_01:4197446..4201207
Strand-
Gene length (bp)3761
Transcript length (bp)3339
Coding sequence length (bp)3339
Protein length (aa) 1113

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01853 MOZ_SAS MOZ/SAS family 1.7E-78 614 793
PF17772 zf-MYST MYST family zinc finger domain 8.9E-20 557 609
PF16866 PHD_4 PHD-finger 1.8E-08 231 287

GO

GO Term Description Terminal node
GO:0016573 histone acetylation Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0004402 histone acetyltransferase activity Yes
GO:0008152 metabolic process No
GO:0008080 N-acetyltransferase activity No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0006473 protein acetylation No
GO:0140096 catalytic activity, acting on a protein No
GO:0043543 protein acylation No
GO:0016746 acyltransferase activity No
GO:0018394 peptidyl-lysine acetylation No
GO:0016740 transferase activity No
GO:0031326 regulation of cellular biosynthetic process No
GO:0018205 peptidyl-lysine modification No
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0016410 N-acyltransferase activity No
GO:0050789 regulation of biological process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0061733 peptide-lysine-N-acetyltransferase activity No
GO:0016407 acetyltransferase activity No
GO:0080090 regulation of primary metabolic process No
GO:0050794 regulation of cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0018393 internal peptidyl-lysine acetylation No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0065007 biological regulation No
GO:0043412 macromolecule modification No
GO:2001141 regulation of RNA biosynthetic process No
GO:0019222 regulation of metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0016570 histone modification No
GO:0044238 primary metabolic process No
GO:0018193 peptidyl-amino acid modification No
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0019538 protein metabolic process No
GO:0006475 internal protein amino acid acetylation No
GO:0031323 regulation of cellular metabolic process No
GO:0034212 peptide N-acetyltransferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1811 0.8993 0.1249 0.0381 0.0677 0.0929 0.0192 0.008 0.0212 0.0041

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4105
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6447
Ophiocordyceps australis map64 (Brazil) OphauB2|7037
Ophiocordyceps camponoti-floridani Ophcf2|01150 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|79
Ophiocordyceps kimflemingae Ophio5|6959
Ophiocordyceps subramaniannii Hirsu2|8302

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01150
MPEASLSSRISARWHINVDRRHTFACCGVQDRRAERLQARRLQLKTASDPRSTCATLSPKCIAFGLESRGNNGDF
ADDGTESTGPPPVADSAEADATATRGGVDSDEGQDDQLSDRDASGEEVDDDAYIEDENDPLTQQIIVGQEPVDGD
DDDDDDDDEDDDREDADDGDEGVGAVKIKPGESVNGDDDEDDDDAESDVSELPSAESDGEVAWEEGDAADEDDDS
EAAPPNTCIFCKQDEENDPSEDFEAFLDCISCGENAHQQCARDAAAMTERNHSKAWKCPDCYAGDSEGDGGDVDI
KDDDASAQCPSRQSSATRAVREHSKSEGPPGNHATTQESDAGDGARTLRKRKTSSAEPEEAPRKRRRNVSSEPSG
QDDAAADRPGEPRTPRVLRLKAQRPPPVVVERRSRTSLVMRITVRPGNLKEILSRKKRDRRRPATTPKPAPPPRA
TPVRPAAVAAAPVTSLPTPFTSDLYSQPFYSLFDKETDDAKGKPYGGILTEAEADTSKTLPAPEDRKRFDQAKQK
AEDEWRARVLAMQAGAEMPVRKPKKANDNASHIECVEFGGWEIDTWYAAPYPAEYSRNRVLYICEFCLKYMNSDY
VAWRHKLKCAAKHPPGDEIYRHESVSIFEVDGRKHPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYILCEYDERGY
HFVGYFSKEKRASSQNNVSCILTLPIHQRKGYGNLLIDFSYLLTKTEQKTGSPEKPLSDMGLVSYRNYWRLELCR
YLLRATQGEAHKRDGLSVKKISDETGMTPDDVVSALEGLRALVRDPQTHLYAFRVDLDYCRQYVAKWESKGYVQL
KPEALAWTPYVMGRSNAVNFELGPPISTIAPREDDEAKVLEGSGSVGSESQPAADSTSGKDGTTPRQEAVVGPEP
VKSIEQVAPEDKENTEPREKDDYDGGGGGGGEGRVPKQKVDWQAAYRDIPPSRFEVFPSVGGGRRADRARPSGGR
MAVARTASSSSRPRRPAGTTSTSRRAAATGRSNTSRRKTGGTGRGPGRWPKGTKKSDYGNADSGPGLPPGWKEKQ
ARMKAEAEVCRVESDIPMDERPAEDEVQVVVAARRPANGKTAHMTSADGDGEDEAMDVHMAG*
Coding >Ophcf2|01150
ATGCCTGAGGCCTCACTCTCGAGCCGCATCTCGGCGCGGTGGCACATCAACGTCGACCGGAGACACACTTTTGCT
TGCTGTGGAGTGCAAGACAGACGAGCCGAGCGGCTCCAGGCTCGCCGTCTCCAGCTCAAGACTGCTTCGGACCCG
AGATCGACATGCGCAACTCTGAGCCCAAAGTGCATCGCTTTCGGTTTGGAAAGCAGGGGTAACAATGGCGACTTT
GCTGACGACGGCACGGAATCTACCGGTCCGCCGCCTGTTGCGGACTCTGCCGAAGCAGACGCGACGGCCACGCGT
GGAGGCGTCGATAGTGACGAGGGCCAAGACGATCAACTCAGCGACAGGGACGCGTCAGGCGAGGAGGTTGACGAT
GACGCGTACATTGAAGATGAAAACGACCCTCTCACTCAACAAATCATCGTTGGCCAGGAGCCGGTAGATGGAGAC
GACGACGACGACGACGACGACGACGAAGACGATGACCGAGAGGACGCAGATGATGGAGACGAAGGCGTCGGAGCC
GTCAAGATCAAACCAGGCGAGTCCGTCAACGGCGACGACGATGAAGACGACGATGATGCGGAGAGCGATGTCTCT
GAGCTTCCGAGCGCCGAGTCTGACGGGGAGGTTGCTTGGGAAGAAGGGGATGCGGCAGATGAAGACGACGACTCG
GAAGCTGCCCCGCCCAATACCTGCATATTCTGCAAGCAGGACGAGGAGAACGATCCCAGTGAAGATTTTGAAGCG
TTTCTGGACTGCATATCATGTGGTGAAAATGCGCATCAGCAGTGTGCACGCGACGCGGCTGCCATGACGGAAAGA
AATCACTCGAAGGCATGGAAATGCCCAGATTGCTACGCCGGAGATTCTGAAGGTGATGGCGGTGACGTCGACATC
AAGGACGACGACGCCAGCGCACAGTGTCCGTCGCGCCAGTCGAGTGCAACTCGGGCAGTACGCGAGCACAGCAAA
TCAGAGGGGCCGCCTGGGAACCATGCCACGACTCAGGAGAGCGACGCCGGTGACGGTGCGCGTACGCTACGCAAA
CGCAAGACATCGTCAGCAGAACCAGAGGAAGCGCCGAGAAAACGACGGAGAAACGTATCGAGCGAGCCAAGTGGC
CAAGACGATGCCGCCGCAGACCGGCCAGGCGAGCCCAGGACGCCGCGGGTTTTGCGGCTCAAGGCGCAGAGGCCC
CCGCCCGTCGTGGTGGAAAGGCGATCGCGAACGTCGCTGGTGATGCGCATAACGGTTCGTCCGGGTAACCTCAAG
GAGATCTTGTCACGCAAGAAACGTGACAGACGACGGCCTGCCACCACCCCAAAGCCCGCCCCTCCGCCCCGAGCG
ACGCCCGTCCGGCCAGCTGCTGTTGCGGCCGCTCCGGTGACTTCGCTTCCGACCCCCTTCACCTCGGATCTATAT
TCACAGCCGTTCTATTCTCTATTCGACAAGGAGACGGACGACGCCAAGGGCAAGCCGTACGGCGGAATCCTTACC
GAAGCCGAGGCAGATACGTCCAAGACGCTACCTGCTCCTGAAGACCGCAAGAGGTTCGATCAGGCCAAGCAAAAG
GCCGAGGACGAGTGGCGAGCTCGCGTCCTGGCGATGCAGGCCGGAGCCGAGATGCCGGTCCGGAAGCCGAAAAAA
GCAAACGACAACGCCAGCCACATCGAGTGCGTCGAGTTCGGCGGGTGGGAGATTGACACCTGGTATGCGGCCCCC
TATCCGGCCGAGTACAGCCGGAACCGTGTGCTCTACATCTGCGAGTTCTGCCTCAAGTACATGAACTCGGACTAT
GTGGCGTGGCGGCACAAGCTCAAGTGCGCGGCCAAACATCCGCCGGGCGACGAGATCTACCGACACGAGTCGGTA
TCCATCTTCGAGGTGGACGGCCGGAAGCATCCGGTCTACTGCCAGAACCTGTGTTTGCTGGCCAAGCTCTTCCTG
GGCTCCAAGACGCTCTACTACGACGTCGAGCCCTTTTTGTTCTATATCCTCTGCGAGTACGACGAGCGAGGATAC
CACTTTGTCGGCTACTTTTCCAAGGAGAAACGGGCCAGCAGTCAGAACAACGTGTCGTGCATCTTGACGTTGCCC
ATACACCAGCGAAAGGGTTACGGTAACCTGCTCATCGACTTTTCCTACCTCTTGACCAAGACGGAGCAGAAGACG
GGCTCGCCCGAGAAGCCGCTGTCGGACATGGGCCTCGTCTCGTACCGCAACTACTGGCGACTAGAGCTGTGCCGA
TACCTTCTGCGAGCCACGCAAGGCGAGGCGCACAAGAGAGACGGCCTCAGCGTCAAGAAGATCTCCGACGAGACG
GGAATGACGCCGGATGACGTCGTTTCGGCCCTAGAAGGCCTGCGTGCCTTGGTACGAGATCCGCAGACGCATCTA
TACGCGTTCCGCGTCGACCTCGACTACTGCCGGCAGTACGTGGCCAAGTGGGAATCCAAGGGCTACGTCCAGCTG
AAGCCCGAGGCCCTGGCTTGGACGCCTTACGTCATGGGTCGCAGCAACGCCGTCAACTTTGAGCTCGGCCCGCCC
ATCAGCACCATAGCGCCGCGCGAGGACGACGAGGCCAAGGTGTTGGAGGGCTCCGGCAGCGTCGGCTCCGAGTCG
CAGCCGGCGGCGGACTCCACAAGCGGCAAGGACGGCACGACTCCCCGGCAGGAAGCCGTCGTGGGTCCGGAGCCT
GTCAAGTCTATCGAGCAGGTAGCACCCGAGGATAAGGAGAACACAGAGCCTCGAGAGAAAGACGATTACGACGGC
GGCGGCGGCGGCGGCGGCGAAGGTAGAGTCCCGAAGCAAAAAGTCGACTGGCAAGCCGCGTACAGAGACATACCA
CCCAGCCGGTTCGAAGTCTTCCCCTCCGTCGGCGGAGGTCGTCGCGCGGATCGGGCCAGACCGAGCGGTGGGAGG
ATGGCGGTGGCGCGGACGGCCAGCAGCTCGTCTCGGCCGCGGCGGCCGGCCGGCACCACCAGCACCAGCCGACGG
GCGGCGGCCACCGGACGCAGCAACACGTCGCGCCGTAAGACGGGAGGCACGGGCCGCGGTCCGGGGCGGTGGCCA
AAGGGAACGAAGAAGTCAGACTATGGGAATGCCGACAGCGGCCCTGGTCTACCGCCCGGTTGGAAGGAGAAGCAG
GCTCGGATGAAGGCCGAGGCCGAGGTTTGTCGGGTCGAGTCGGACATACCGATGGACGAGCGGCCTGCGGAAGAC
GAGGTACAGGTGGTGGTAGCGGCCAGACGGCCTGCCAACGGCAAGACAGCGCACATGACGTCGGCCGACGGCGAT
GGAGAGGATGAGGCCATGGACGTGCATATGGCAGGTTGA
Transcript >Ophcf2|01150
ATGCCTGAGGCCTCACTCTCGAGCCGCATCTCGGCGCGGTGGCACATCAACGTCGACCGGAGACACACTTTTGCT
TGCTGTGGAGTGCAAGACAGACGAGCCGAGCGGCTCCAGGCTCGCCGTCTCCAGCTCAAGACTGCTTCGGACCCG
AGATCGACATGCGCAACTCTGAGCCCAAAGTGCATCGCTTTCGGTTTGGAAAGCAGGGGTAACAATGGCGACTTT
GCTGACGACGGCACGGAATCTACCGGTCCGCCGCCTGTTGCGGACTCTGCCGAAGCAGACGCGACGGCCACGCGT
GGAGGCGTCGATAGTGACGAGGGCCAAGACGATCAACTCAGCGACAGGGACGCGTCAGGCGAGGAGGTTGACGAT
GACGCGTACATTGAAGATGAAAACGACCCTCTCACTCAACAAATCATCGTTGGCCAGGAGCCGGTAGATGGAGAC
GACGACGACGACGACGACGACGACGAAGACGATGACCGAGAGGACGCAGATGATGGAGACGAAGGCGTCGGAGCC
GTCAAGATCAAACCAGGCGAGTCCGTCAACGGCGACGACGATGAAGACGACGATGATGCGGAGAGCGATGTCTCT
GAGCTTCCGAGCGCCGAGTCTGACGGGGAGGTTGCTTGGGAAGAAGGGGATGCGGCAGATGAAGACGACGACTCG
GAAGCTGCCCCGCCCAATACCTGCATATTCTGCAAGCAGGACGAGGAGAACGATCCCAGTGAAGATTTTGAAGCG
TTTCTGGACTGCATATCATGTGGTGAAAATGCGCATCAGCAGTGTGCACGCGACGCGGCTGCCATGACGGAAAGA
AATCACTCGAAGGCATGGAAATGCCCAGATTGCTACGCCGGAGATTCTGAAGGTGATGGCGGTGACGTCGACATC
AAGGACGACGACGCCAGCGCACAGTGTCCGTCGCGCCAGTCGAGTGCAACTCGGGCAGTACGCGAGCACAGCAAA
TCAGAGGGGCCGCCTGGGAACCATGCCACGACTCAGGAGAGCGACGCCGGTGACGGTGCGCGTACGCTACGCAAA
CGCAAGACATCGTCAGCAGAACCAGAGGAAGCGCCGAGAAAACGACGGAGAAACGTATCGAGCGAGCCAAGTGGC
CAAGACGATGCCGCCGCAGACCGGCCAGGCGAGCCCAGGACGCCGCGGGTTTTGCGGCTCAAGGCGCAGAGGCCC
CCGCCCGTCGTGGTGGAAAGGCGATCGCGAACGTCGCTGGTGATGCGCATAACGGTTCGTCCGGGTAACCTCAAG
GAGATCTTGTCACGCAAGAAACGTGACAGACGACGGCCTGCCACCACCCCAAAGCCCGCCCCTCCGCCCCGAGCG
ACGCCCGTCCGGCCAGCTGCTGTTGCGGCCGCTCCGGTGACTTCGCTTCCGACCCCCTTCACCTCGGATCTATAT
TCACAGCCGTTCTATTCTCTATTCGACAAGGAGACGGACGACGCCAAGGGCAAGCCGTACGGCGGAATCCTTACC
GAAGCCGAGGCAGATACGTCCAAGACGCTACCTGCTCCTGAAGACCGCAAGAGGTTCGATCAGGCCAAGCAAAAG
GCCGAGGACGAGTGGCGAGCTCGCGTCCTGGCGATGCAGGCCGGAGCCGAGATGCCGGTCCGGAAGCCGAAAAAA
GCAAACGACAACGCCAGCCACATCGAGTGCGTCGAGTTCGGCGGGTGGGAGATTGACACCTGGTATGCGGCCCCC
TATCCGGCCGAGTACAGCCGGAACCGTGTGCTCTACATCTGCGAGTTCTGCCTCAAGTACATGAACTCGGACTAT
GTGGCGTGGCGGCACAAGCTCAAGTGCGCGGCCAAACATCCGCCGGGCGACGAGATCTACCGACACGAGTCGGTA
TCCATCTTCGAGGTGGACGGCCGGAAGCATCCGGTCTACTGCCAGAACCTGTGTTTGCTGGCCAAGCTCTTCCTG
GGCTCCAAGACGCTCTACTACGACGTCGAGCCCTTTTTGTTCTATATCCTCTGCGAGTACGACGAGCGAGGATAC
CACTTTGTCGGCTACTTTTCCAAGGAGAAACGGGCCAGCAGTCAGAACAACGTGTCGTGCATCTTGACGTTGCCC
ATACACCAGCGAAAGGGTTACGGTAACCTGCTCATCGACTTTTCCTACCTCTTGACCAAGACGGAGCAGAAGACG
GGCTCGCCCGAGAAGCCGCTGTCGGACATGGGCCTCGTCTCGTACCGCAACTACTGGCGACTAGAGCTGTGCCGA
TACCTTCTGCGAGCCACGCAAGGCGAGGCGCACAAGAGAGACGGCCTCAGCGTCAAGAAGATCTCCGACGAGACG
GGAATGACGCCGGATGACGTCGTTTCGGCCCTAGAAGGCCTGCGTGCCTTGGTACGAGATCCGCAGACGCATCTA
TACGCGTTCCGCGTCGACCTCGACTACTGCCGGCAGTACGTGGCCAAGTGGGAATCCAAGGGCTACGTCCAGCTG
AAGCCCGAGGCCCTGGCTTGGACGCCTTACGTCATGGGTCGCAGCAACGCCGTCAACTTTGAGCTCGGCCCGCCC
ATCAGCACCATAGCGCCGCGCGAGGACGACGAGGCCAAGGTGTTGGAGGGCTCCGGCAGCGTCGGCTCCGAGTCG
CAGCCGGCGGCGGACTCCACAAGCGGCAAGGACGGCACGACTCCCCGGCAGGAAGCCGTCGTGGGTCCGGAGCCT
GTCAAGTCTATCGAGCAGGTAGCACCCGAGGATAAGGAGAACACAGAGCCTCGAGAGAAAGACGATTACGACGGC
GGCGGCGGCGGCGGCGGCGAAGGTAGAGTCCCGAAGCAAAAAGTCGACTGGCAAGCCGCGTACAGAGACATACCA
CCCAGCCGGTTCGAAGTCTTCCCCTCCGTCGGCGGAGGTCGTCGCGCGGATCGGGCCAGACCGAGCGGTGGGAGG
ATGGCGGTGGCGCGGACGGCCAGCAGCTCGTCTCGGCCGCGGCGGCCGGCCGGCACCACCAGCACCAGCCGACGG
GCGGCGGCCACCGGACGCAGCAACACGTCGCGCCGTAAGACGGGAGGCACGGGCCGCGGTCCGGGGCGGTGGCCA
AAGGGAACGAAGAAGTCAGACTATGGGAATGCCGACAGCGGCCCTGGTCTACCGCCCGGTTGGAAGGAGAAGCAG
GCTCGGATGAAGGCCGAGGCCGAGGTTTGTCGGGTCGAGTCGGACATACCGATGGACGAGCGGCCTGCGGAAGAC
GAGGTACAGGTGGTGGTAGCGGCCAGACGGCCTGCCAACGGCAAGACAGCGCACATGACGTCGGCCGACGGCGAT
GGAGAGGATGAGGCCATGGACGTGCATATGGCAGGTTGA
Gene >Ophcf2|01150
ATGCCTGAGGCCTCACTCTCGAGCCGCATCTCGGCGCGGTGGCACAGTTAGTCCGGAGCAGATCTCCACACTGTA
CTGCCACGTTACCCCTTGGCAGCTGCCACGTTCTGAAGCGCGCGCGCGCACTGTAGCGACGAGCCTGGGTGCGCT
CTCTCTTGCCTCGCCAAAGGGAAAAAAAAAAAACCAACAAGACGCGACTCAGCAAGGCTCGCTTCTCGCTCTAAG
TCAACGTCGACCGGAGACACACTTTTGCTTGCTGTGGAGTGCAAGACAGACGAGTCTGTCGCGTGTCCCTTCCGG
CCAGAGCTGTCACTGACCATACGCGCAAGGCCGAGCGGCTCCAGGCTCGCCGTCTCCAGCTCAAGACTGCTTCGG
ACCCGAGATCGACATGCGCAACTCTGAGCCCAAAGTGCATCGCTTTCGGTTTGGAAAGCAGGGGTAACAATGGCG
AGTGCGCAAGCGATGGAGGAAGAGTTGCAGCAGAGTGTCTTGCTCTCCGAAGAAGCGGAATACGAGACGGCCGAT
AGCTTTGCTGACGACGGCACGGAATCTACCGGTCCGCCGCCTGTTGCGGACTCTGCCGAAGCAGACGCGACGGCC
ACGCGTGGAGGCGTCGATAGTGACGAGGGCCAAGACGATCAACTCAGCGACAGGGACGCGTCAGGCGAGGAGGTT
GACGATGACGCGTACATTGAAGATGAAAACGACCCTCTCACTCAACAAATCATCGTTGGCCAGGAGCCGGTAGAT
GGAGACGACGACGACGACGACGACGACGACGAAGACGATGACCGAGAGGACGCAGATGATGGAGACGAAGGCGTC
GGAGCCGTCAAGATCAAACCAGGCGAGTCCGTCAACGGCGACGACGATGAAGACGACGATGATGCGGAGAGCGAT
GTCTCTGAGCTTCCGAGCGCCGAGTCTGACGGGGAGGTTGCTTGGGAAGAAGGGGATGCGGCAGATGAAGACGAC
GACTCGGAAGCTGCCCCGCCCAATACCTGCATATTCTGCAAGCAGGACGAGGAGAACGATCCCAGTGAAGATTTT
GAAGCGTTTCTGGACTGCATATCATGTGGTGAAAATGGTAATTTTCTCCCGAGCCTGGCGTCCGGCCGAAGGCAT
CAACTAACAGGCATCAGCGCATCAGCAGTGTGCACGCGACGCGGCTGCCATGACGGAAAGAAATCGTGGGTGGTT
GCAGAATCGAGTGATGGATGCCTTGGCCCGGGCCCGCTGACGAATGCGCAGACTCGAAGGCATGGAAATGCCCAG
ATTGCTACGCCGGAGATTCTGAAGGTGATGGCGGTGACGTCGACATCAAGGACGACGACGCCAGCGCACAGTGTC
CGTCGCGCCAGTCGAGTGCAACTCGGGCAGTACGCGAGCACAGCAAATCAGAGGGGCCGCCTGGGAACCATGCCA
CGACTCAGGAGAGCGACGCCGGTGACGGTGCGCGTACGCTACGCAAACGCAAGACATCGTCAGCAGAACCAGAGG
AAGCGCCGAGAAAACGACGGAGAAACGTATCGAGCGAGCCAAGTGGCCAAGACGATGCCGCCGCAGACCGGCCAG
GCGAGCCCAGGACGCCGCGGGTTTTGCGGCTCAAGGCGCAGAGGCCCCCGCCCGTCGTGGTGGAAAGGCGATCGC
GAACGTCGCTGGTGATGCGCATAACGGTTCGTCCGGGTAACCTCAAGGAGATCTTGTCACGCAAGAAACGTGACA
GACGACGGCCTGCCACCACCCCAAAGCCCGCCCCTCCGCCCCGAGCGACGCCCGTCCGGCCAGCTGCTGTTGCGG
CCGCTCCGGTGACTTCGCTTCCGACCCCCTTCACCTCGGATCTATATTCACAGCCGTTCTATTCTCTATTCGACA
AGGAGACGGACGACGCCAAGGGCAAGCCGTACGGCGGAATCCTTACCGAAGCCGAGGCAGATACGTCCAAGACGC
TACCTGCTCCTGAAGACCGCAAGAGGTTCGATCAGGCCAAGCAAAAGGCCGAGGACGAGTGGCGAGCTCGCGTCC
TGGCGATGCAGGCCGGAGCCGAGATGCCGGTCCGGAAGCCGAAAAAAGCAAACGACAACGCCAGCCACATCGAGT
GCGTCGAGTTCGGCGGGTGGGAGATTGACACCTGGTATGCGGCCCCCTATCCGGCCGAGTACAGCCGGAACCGTG
TGCTCTACATCTGCGAGTTCTGCCTCAAGTACATGAACTCGGACTATGTGGCGTGGCGGCACAAGCTCAAGTGCG
CGGCCAAACATCCGCCGGGCGACGAGATCTACCGACACGAGTCGGTATCCATCTTCGAGGTGGACGGCCGGAAGC
ATCCGGTCTACTGCCAGAACCTGTGTTTGCTGGCCAAGCTCTTCCTGGGCTCCAAGACGCTCTACTACGACGTCG
AGCCCTTTTTGTTCTATATCCTCTGCGAGTACGACGAGCGAGGATACCACTTTGTCGGCTACTTTTCCAAGGAGA
AACGGGCCAGCAGTCAGAACAACGTGTCGTGCATCTTGACGTTGCCCATACACCAGCGAAAGGGTTACGGTAACC
TGCTCATCGACTTTTCCTACCTCTTGACCAAGACGGAGCAGAAGACGGGCTCGCCCGAGAAGCCGCTGTCGGACA
TGGGCCTCGTCTCGTACCGCAACTACTGGCGACTAGAGCTGTGCCGATACCTTCTGCGAGCCACGCAAGGCGAGG
CGCACAAGAGAGACGGCCTCAGCGTCAAGAAGATCTCCGACGAGACGGGAATGACGCCGGATGACGTCGTTTCGG
CCCTAGAAGGCCTGCGTGCCTTGGTACGAGATCCGCAGACGCATCTATACGCGTTCCGCGTCGACCTCGACTACT
GCCGGCAGTACGTGGCCAAGTGGGAATCCAAGGGCTACGTCCAGCTGAAGCCCGAGGCCCTGGCTTGGACGCCTT
ACGTCATGGGTCGCAGCAACGCCGTCAACTTTGAGCTCGGCCCGCCCATCAGCACCATAGCGCCGCGCGAGGACG
ACGAGGCCAAGGTGTTGGAGGGCTCCGGCAGCGTCGGCTCCGAGTCGCAGCCGGCGGCGGACTCCACAAGCGGCA
AGGACGGCACGACTCCCCGGCAGGAAGCCGTCGTGGGTCCGGAGCCTGTCAAGTCTATCGAGCAGGTAGCACCCG
AGGATAAGGAGAACACAGAGCCTCGAGAGAAAGACGATTACGACGGCGGCGGCGGCGGCGGCGGCGAAGGTAGAG
TCCCGAAGCAAAAAGTCGACTGGCAAGCCGCGTACAGAGACATACCACCCAGCCGGTTCGAAGTCTTCCCCTCCG
TCGGCGGAGGTCGTCGCGCGGATCGGGCCAGACCGAGCGGTGGGAGGATGGCGGTGGCGCGGACGGCCAGCAGCT
CGTCTCGGCCGCGGCGGCCGGCCGGCACCACCAGCACCAGCCGACGGGCGGCGGCCACCGGACGCAGCAACACGT
CGCGCCGTAAGACGGGAGGCACGGGCCGCGGTCCGGGGCGGTGGCCAAAGGGAACGAAGAAGTCAGACTATGGGA
ATGCCGACAGCGGCCCTGGTCTACCGCCCGGTTGGAAGGAGAAGCAGGCTCGGATGAAGGCCGAGGCCGAGGTTT
GTCGGGTCGAGTCGGACATACCGATGGACGAGCGGCCTGCGGAAGACGAGGTACAGGTGGTGGTAGCGGCCAGAC
GGCCTGCCAACGGCAAGACAGCGCACATGACGTCGGCCGACGGCGATGGAGAGGATGAGGCCATGGACGTGCATA
TGGCAGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail