Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01141
Gene name
Locationscaffold_01:4168491..4172513
Strand+
Gene length (bp)4022
Transcript length (bp)3399
Coding sequence length (bp)3399
Protein length (aa) 1133

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 9.5E-103 463 776
PF00929 RNase_T Exonuclease 1.5E-21 852 1025

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01141
MDGDWDEVSRIPFPSSGVHAMPTPVTTMTFDTSQELLWTGNDYGRVMSFLGTEQQRYTSFKAHQAIDGPVRQILV
NDKGVIALGSRDIHMALRRGPPIWHIRHDEMSELRCMTFTSKGASEILVAGLQNKMLVIDINKGEVIEQLHSEYH
YTAMKRGRYICAATKHGAVHLLDPANFSVVRIWNAHSALVNDIDAQHDFIVTCGYSLRQGQNYMLDPFLNVFDIK
KMSSMAPIPFPAGAAYVRMHPRMLTTSIVVSQTGQMHVVDLMNPNTSNVRQANVLSYLSMFEIAPSGEAMALADA
ECFIHLWGSPSKLHFVDLPAPVEFATPEEPMPPIDWTSETPLNSVGLPYYREVLASAMPDTVSDVGAPPPIRCSV
ENTRNVNRSASAGLKAPKFLSEKARESAKSDVKSADDKTDDLTSPTGETISGHKKSDVPMMYRNVEIKYSKFGVD
DFDFGFYNKTCYSGLEIHISNSYANSLLQVMNFTPLVRNMALQHAATSCINDLCLLCELGFLFDMLQKADGSICQ
ATNLLRTLSGHPQAAPLGLLEEDSHGSSLNLMLQGLTRFLLDKIVADYKCMPPASSALEQVLATSATSSIRCMNC
RSEYTRPGSTFVTDLLYPPHKSSGRNSKMPRFTFSQILKSSIERETTSKGWCGRCQRYQTIATRKTIHNIPAVLM
LNTAITNQDHRMLWSTPGFLPDEIGIIVDQGQFYCYEGEDLKLHLQRGMHSITVYSLMGMAVNIEGGQTQKSHLV
SVVNVAHSEPQWPGQSQWHLFNDFLVRSISREEALTFNQSWKTPSVVAFQVKHANNKMDTEWKDHLDTSILYHDL
SPGLHPENQTYRILDHETERPGPGTIVALDTEFVAVRQPEIEMNSDGERETIRPIVYALARASVLRGQGEKEGTP
FVDDYIAIKEPIVDYLTSYSGIREEDLDPRLSKHSLLSLKMAYKKLWILLNLGCRFLGHGLKQDFRVINIHVPKA
QVIDTIDLFYLKSRLRKLSLAFLAWYLLKEDIQMETHDSIEDSRTALRLYRKYLEFQDAGVLEAMLQDIYRVGRE
VNFKPPRADVERTDTPPPLPVEGSVPATDAASAAATVAATVAAPTTPVAKTVGLASSASAHIAPAAGFGGPSWTP
GKGSPMK*
Coding >Ophcf2|01141
ATGGATGGAGACTGGGATGAGGTTTCCCGCATTCCCTTTCCGTCCTCGGGCGTACACGCGATGCCCACGCCCGTG
ACTACCATGACGTTTGACACCTCGCAGGAGCTGCTCTGGACTGGAAACGACTACGGACGCGTCATGTCCTTTCTC
GGAACCGAGCAGCAGAGGTACACGTCGTTCAAGGCCCATCAGGCCATAGATGGACCTGTACGACAGATCCTGGTC
AACGACAAGGGCGTGATAGCACTGGGCTCAAGAGACATACATATGGCCTTGAGAAGAGGACCCCCGATTTGGCAC
ATCAGGCACGATGAGATGAGCGAGCTGCGGTGCATGACCTTCACCTCGAAAGGAGCTTCGGAGATTCTCGTTGCT
GGACTACAGAACAAGATGCTCGTCATCGACATCAACAAGGGCGAGGTCATCGAGCAGCTGCATAGCGAGTACCAT
TATACAGCCATGAAGCGAGGCCGTTACATCTGCGCCGCCACCAAGCACGGAGCTGTCCATCTCCTGGACCCTGCC
AACTTTTCCGTCGTTAGAATCTGGAACGCACATTCGGCGCTGGTCAACGACATTGACGCGCAACACGACTTCATC
GTCACTTGCGGGTATTCCTTGCGGCAGGGACAGAACTACATGCTGGATCCGTTCCTCAACGTCTTCGACATCAAG
AAAATGTCCTCGATGGCCCCTATACCTTTCCCGGCAGGGGCGGCCTACGTGCGAATGCACCCGCGCATGCTCACC
ACCAGCATTGTCGTGTCCCAGACCGGTCAGATGCATGTCGTGGACCTTATGAATCCAAACACGAGCAATGTCCGA
CAAGCCAACGTCCTCTCCTATCTGAGTATGTTTGAGATTGCTCCTTCGGGCGAAGCCATGGCGCTCGCCGATGCC
GAGTGCTTCATCCATCTATGGGGCTCACCTTCAAAGTTGCATTTCGTCGACCTGCCGGCTCCGGTGGAGTTTGCA
ACTCCCGAGGAACCAATGCCGCCTATCGACTGGACGTCCGAGACACCCTTGAACTCGGTAGGTCTGCCGTACTAT
CGAGAGGTTCTGGCGTCGGCAATGCCCGACACCGTCTCCGACGTCGGCGCCCCCCCCCCGATTCGATGTTCAGTC
GAGAACACGCGCAACGTCAACAGGTCCGCCAGCGCCGGACTGAAGGCCCCCAAGTTTCTGAGCGAGAAGGCTCGT
GAGTCTGCTAAGAGCGACGTCAAGAGCGCCGACGATAAGACGGACGACCTCACCAGTCCCACGGGGGAAACCATA
TCCGGACATAAGAAATCCGACGTGCCAATGATGTACAGAAACGTGGAGATCAAGTACAGCAAGTTCGGCGTCGAC
GACTTTGATTTTGGCTTCTACAACAAGACGTGTTACTCCGGCTTGGAGATTCATATTTCAAACTCGTACGCAAAC
TCGCTGCTCCAGGTGATGAACTTCACACCCCTGGTTCGCAACATGGCTCTCCAGCATGCCGCGACGTCCTGTATC
AACGATCTCTGCCTGTTGTGCGAGCTGGGCTTTCTGTTCGACATGCTGCAGAAAGCTGACGGGTCTATTTGCCAA
GCAACCAATCTTCTCAGGACGCTCAGCGGTCATCCTCAAGCCGCTCCGTTGGGACTCCTCGAGGAGGACTCTCAC
GGGTCGTCGTTGAACCTCATGCTGCAGGGCCTCACCCGCTTCCTCCTCGACAAGATTGTGGCTGACTACAAGTGC
ATGCCTCCGGCGTCTTCGGCTCTGGAACAGGTTCTCGCAACGTCGGCTACAAGCTCCATCAGATGCATGAACTGT
AGGAGCGAGTACACGAGGCCCGGTTCGACATTCGTGACGGACCTGCTCTACCCTCCCCACAAATCGTCGGGCCGC
AACAGCAAAATGCCTCGTTTCACCTTCTCCCAAATTCTGAAGAGCAGCATCGAGAGAGAGACGACATCTAAGGGA
TGGTGTGGCCGATGTCAGCGATATCAGACCATTGCGACGAGAAAGACGATCCATAATATACCGGCCGTGCTGATG
CTCAACACGGCCATCACGAACCAGGATCATCGAATGCTCTGGTCTACTCCCGGGTTTCTCCCGGATGAGATTGGA
ATCATCGTCGACCAAGGCCAGTTTTACTGCTACGAGGGCGAAGACCTCAAGCTCCATCTCCAGCGGGGCATGCAC
AGCATCACCGTCTACTCGCTCATGGGCATGGCCGTGAATATCGAGGGCGGTCAGACGCAGAAGTCCCATCTCGTA
TCCGTGGTCAACGTTGCCCATTCCGAACCTCAGTGGCCGGGACAGAGCCAGTGGCATCTGTTCAATGACTTCTTG
GTCCGCTCCATCAGTAGAGAAGAGGCCCTGACCTTTAACCAATCCTGGAAGACGCCTTCGGTTGTGGCCTTTCAG
GTCAAGCACGCCAACAACAAGATGGACACGGAGTGGAAGGACCATCTCGATACATCCATCCTCTATCACGATCTC
AGCCCAGGTTTGCATCCCGAAAACCAGACATATCGGATCCTGGACCATGAGACGGAGCGCCCCGGGCCGGGGACC
ATCGTGGCCCTCGACACGGAGTTTGTCGCGGTTCGGCAGCCGGAAATCGAGATGAACTCGGACGGAGAGCGGGAG
ACAATCCGTCCCATTGTCTATGCGCTCGCTCGAGCATCGGTGTTGCGAGGACAGGGTGAGAAGGAGGGGACGCCG
TTCGTGGACGACTACATTGCCATCAAGGAGCCCATCGTCGACTACCTGACGTCGTACTCGGGCATCCGGGAGGAG
GATCTAGATCCGCGCCTCTCCAAGCACAGTCTCTTGTCGCTCAAGATGGCGTACAAGAAGCTCTGGATCCTGCTC
AACTTGGGCTGTAGATTCCTCGGACACGGGCTGAAGCAGGACTTTCGCGTCATCAACATCCACGTACCCAAGGCG
CAAGTCATAGACACCATCGACCTCTTCTATCTCAAGTCACGTCTGCGCAAGCTATCACTCGCCTTTTTGGCTTGG
TACCTCCTCAAAGAGGACATCCAGATGGAGACGCACGACTCCATCGAAGACTCGCGCACCGCCCTCAGGCTGTAT
CGCAAATATCTCGAATTCCAAGACGCCGGTGTGCTCGAAGCGATGCTGCAGGATATATACCGCGTCGGCCGCGAA
GTCAACTTCAAACCACCGCGCGCCGACGTCGAGAGGACCGACACGCCGCCCCCGTTGCCTGTCGAGGGCTCCGTT
CCGGCTACCGACGCCGCCTCCGCCGCCGCCACCGTCGCCGCCACCGTGGCCGCGCCGACGACGCCCGTGGCCAAG
ACGGTCGGCCTCGCGTCGTCGGCTTCTGCTCACATTGCCCCGGCGGCTGGCTTTGGGGGGCCGTCTTGGACGCCG
GGCAAGGGGTCGCCTATGAAGTAA
Transcript >Ophcf2|01141
ATGGATGGAGACTGGGATGAGGTTTCCCGCATTCCCTTTCCGTCCTCGGGCGTACACGCGATGCCCACGCCCGTG
ACTACCATGACGTTTGACACCTCGCAGGAGCTGCTCTGGACTGGAAACGACTACGGACGCGTCATGTCCTTTCTC
GGAACCGAGCAGCAGAGGTACACGTCGTTCAAGGCCCATCAGGCCATAGATGGACCTGTACGACAGATCCTGGTC
AACGACAAGGGCGTGATAGCACTGGGCTCAAGAGACATACATATGGCCTTGAGAAGAGGACCCCCGATTTGGCAC
ATCAGGCACGATGAGATGAGCGAGCTGCGGTGCATGACCTTCACCTCGAAAGGAGCTTCGGAGATTCTCGTTGCT
GGACTACAGAACAAGATGCTCGTCATCGACATCAACAAGGGCGAGGTCATCGAGCAGCTGCATAGCGAGTACCAT
TATACAGCCATGAAGCGAGGCCGTTACATCTGCGCCGCCACCAAGCACGGAGCTGTCCATCTCCTGGACCCTGCC
AACTTTTCCGTCGTTAGAATCTGGAACGCACATTCGGCGCTGGTCAACGACATTGACGCGCAACACGACTTCATC
GTCACTTGCGGGTATTCCTTGCGGCAGGGACAGAACTACATGCTGGATCCGTTCCTCAACGTCTTCGACATCAAG
AAAATGTCCTCGATGGCCCCTATACCTTTCCCGGCAGGGGCGGCCTACGTGCGAATGCACCCGCGCATGCTCACC
ACCAGCATTGTCGTGTCCCAGACCGGTCAGATGCATGTCGTGGACCTTATGAATCCAAACACGAGCAATGTCCGA
CAAGCCAACGTCCTCTCCTATCTGAGTATGTTTGAGATTGCTCCTTCGGGCGAAGCCATGGCGCTCGCCGATGCC
GAGTGCTTCATCCATCTATGGGGCTCACCTTCAAAGTTGCATTTCGTCGACCTGCCGGCTCCGGTGGAGTTTGCA
ACTCCCGAGGAACCAATGCCGCCTATCGACTGGACGTCCGAGACACCCTTGAACTCGGTAGGTCTGCCGTACTAT
CGAGAGGTTCTGGCGTCGGCAATGCCCGACACCGTCTCCGACGTCGGCGCCCCCCCCCCGATTCGATGTTCAGTC
GAGAACACGCGCAACGTCAACAGGTCCGCCAGCGCCGGACTGAAGGCCCCCAAGTTTCTGAGCGAGAAGGCTCGT
GAGTCTGCTAAGAGCGACGTCAAGAGCGCCGACGATAAGACGGACGACCTCACCAGTCCCACGGGGGAAACCATA
TCCGGACATAAGAAATCCGACGTGCCAATGATGTACAGAAACGTGGAGATCAAGTACAGCAAGTTCGGCGTCGAC
GACTTTGATTTTGGCTTCTACAACAAGACGTGTTACTCCGGCTTGGAGATTCATATTTCAAACTCGTACGCAAAC
TCGCTGCTCCAGGTGATGAACTTCACACCCCTGGTTCGCAACATGGCTCTCCAGCATGCCGCGACGTCCTGTATC
AACGATCTCTGCCTGTTGTGCGAGCTGGGCTTTCTGTTCGACATGCTGCAGAAAGCTGACGGGTCTATTTGCCAA
GCAACCAATCTTCTCAGGACGCTCAGCGGTCATCCTCAAGCCGCTCCGTTGGGACTCCTCGAGGAGGACTCTCAC
GGGTCGTCGTTGAACCTCATGCTGCAGGGCCTCACCCGCTTCCTCCTCGACAAGATTGTGGCTGACTACAAGTGC
ATGCCTCCGGCGTCTTCGGCTCTGGAACAGGTTCTCGCAACGTCGGCTACAAGCTCCATCAGATGCATGAACTGT
AGGAGCGAGTACACGAGGCCCGGTTCGACATTCGTGACGGACCTGCTCTACCCTCCCCACAAATCGTCGGGCCGC
AACAGCAAAATGCCTCGTTTCACCTTCTCCCAAATTCTGAAGAGCAGCATCGAGAGAGAGACGACATCTAAGGGA
TGGTGTGGCCGATGTCAGCGATATCAGACCATTGCGACGAGAAAGACGATCCATAATATACCGGCCGTGCTGATG
CTCAACACGGCCATCACGAACCAGGATCATCGAATGCTCTGGTCTACTCCCGGGTTTCTCCCGGATGAGATTGGA
ATCATCGTCGACCAAGGCCAGTTTTACTGCTACGAGGGCGAAGACCTCAAGCTCCATCTCCAGCGGGGCATGCAC
AGCATCACCGTCTACTCGCTCATGGGCATGGCCGTGAATATCGAGGGCGGTCAGACGCAGAAGTCCCATCTCGTA
TCCGTGGTCAACGTTGCCCATTCCGAACCTCAGTGGCCGGGACAGAGCCAGTGGCATCTGTTCAATGACTTCTTG
GTCCGCTCCATCAGTAGAGAAGAGGCCCTGACCTTTAACCAATCCTGGAAGACGCCTTCGGTTGTGGCCTTTCAG
GTCAAGCACGCCAACAACAAGATGGACACGGAGTGGAAGGACCATCTCGATACATCCATCCTCTATCACGATCTC
AGCCCAGGTTTGCATCCCGAAAACCAGACATATCGGATCCTGGACCATGAGACGGAGCGCCCCGGGCCGGGGACC
ATCGTGGCCCTCGACACGGAGTTTGTCGCGGTTCGGCAGCCGGAAATCGAGATGAACTCGGACGGAGAGCGGGAG
ACAATCCGTCCCATTGTCTATGCGCTCGCTCGAGCATCGGTGTTGCGAGGACAGGGTGAGAAGGAGGGGACGCCG
TTCGTGGACGACTACATTGCCATCAAGGAGCCCATCGTCGACTACCTGACGTCGTACTCGGGCATCCGGGAGGAG
GATCTAGATCCGCGCCTCTCCAAGCACAGTCTCTTGTCGCTCAAGATGGCGTACAAGAAGCTCTGGATCCTGCTC
AACTTGGGCTGTAGATTCCTCGGACACGGGCTGAAGCAGGACTTTCGCGTCATCAACATCCACGTACCCAAGGCG
CAAGTCATAGACACCATCGACCTCTTCTATCTCAAGTCACGTCTGCGCAAGCTATCACTCGCCTTTTTGGCTTGG
TACCTCCTCAAAGAGGACATCCAGATGGAGACGCACGACTCCATCGAAGACTCGCGCACCGCCCTCAGGCTGTAT
CGCAAATATCTCGAATTCCAAGACGCCGGTGTGCTCGAAGCGATGCTGCAGGATATATACCGCGTCGGCCGCGAA
GTCAACTTCAAACCACCGCGCGCCGACGTCGAGAGGACCGACACGCCGCCCCCGTTGCCTGTCGAGGGCTCCGTT
CCGGCTACCGACGCCGCCTCCGCCGCCGCCACCGTCGCCGCCACCGTGGCCGCGCCGACGACGCCCGTGGCCAAG
ACGGTCGGCCTCGCGTCGTCGGCTTCTGCTCACATTGCCCCGGCGGCTGGCTTTGGGGGGCCGTCTTGGACGCCG
GGCAAGGGGTCGCCTATGAAGTAA
Gene >Ophcf2|01141
ATGGATGGAGACTGGGATGAGGTTCGTCGTCTATCCACGCCGTCTGCCGTTTGTGCCGACGCGCTTCATGAAGCC
TGCTGATGCATCGTGTTTCCAGGTTTCCCGCATTCCCTTTCCGTCCTCGGGCGTACACGCGATGCCCACGCCCGT
GACTACCATGACGTTTGACACCTCGCAGGAGCTGCTCTGGACTGGAAACGACTACGTACGCAAAATCCCTTCTAG
CCTCCCTTGTTATGTGACTGACAGCTCGGATAGGGACGCGTCATGTCCTTTCTCGGAACCGAGCAGCAGAGGTAC
ACGTCGTTCAAGGCCCATCAGGCCATAGATGGACCTGTACGACAGATCCTGGTCAACGACAAGGGCGTGATAGCA
CTGGGCTCAAGAGACATACATATGGCCTTGAGAAGAGGACCCCCGATTTGGCACATCAGGTATGTCTTTTCCACC
GGTCCCGCAAAACGTAATCTAATCATGCGTTCTTTAGGCACGATGAGATGAGCGAGCTGCGGTGCATGACCTTCA
CCTCGAAAGGAGCTTCGGAGATTCTCGTTGCTGGACTACAGAACAAGATGCTCGTCATCGACATCAACAAGGGCG
AGGTCATCGAGCAGCTGCATAGCGAGTACCATTATACAGCCATGAAGCGAGGCCGTTACATCTGCGCCGCCACCA
AGCACGGAGCTGTCCATCTCCTGGACCCTGCCAACTTTTCCGTCGTTAGAATCTGGAACGCACATTCGGCGCTGG
TCAACGACATTGACGCGCAACACGACTTCATCGTCACTTGCGGGTATTCCTTGCGGCAGGGACAGAACTACATGC
TGGATCCGTTCCTCAACGTCTTCGACATCAAGAAAATGTCCTCGATGGCCCCTATACCTTTCCCGGCAGGGGCGG
CCTACGTGCGAATGCACCCGCGCATGCTCACCACCAGCATTGTCGTGTCCCAGACCGGTCAGATGCATGTCGTGG
ACCTTATGAATCCAAACACGAGCAATGTCCGACAAGCCAACGTCCTCTCCTATCTGAGTATGTTTGAGATTGCTC
CTTCGGGCGAAGCCATGGCGCTCGCCGATGCCGAGTGCTTCATCCATCTATGGGGCTCACCTTCAAAGTTGCATT
TCGTCGACCTGCCGGCTCCGGTGGAGTTTGCAACTCCCGAGGAACCAATGCCGCCTATCGACTGGACGTCCGAGA
CGTAAGATGAACCCCTCCCCGTCGTTTCGACGACGACAAAGACTGACATGGCTTATAGACCCTTGAACTCGGTAG
GTCTGCCGTACTATCGAGAGGTTCTGGCGTCGGCAATGCCCGACACCGTCTCCGACGTCGGCGCCCCCCCCCCGA
TTCGATGTTCAGTTCGTCAACAGCCTAAAGGCGGCCGATTTTGGTATGTATGGCCGAAACACCCGTGGCGTCCGA
CGAAATCAGGTCGAGAACACGCGCAACGTCAACAGGTCCGCCAGCGCCGGACTGAAGGCCCCCAAGTTTCTGAGC
GAGAAGGCTCGTGAGTCTGCTAAGAGCGACGTCAAGAGCGCCGACGATAAGACGGACGACCTCACCAGTCCCACG
GGGGAAACCATATCCGGACATAAGAAATCCGACGTGCCAATGATGTACAGAAACGTGGAGATCAAGTACAGCAAG
TTCGGCGTCGACGACTTTGATTTTGGGTACGTCCATTCCCGACTTCTGCGCAAGGACAGACTGCTAAGAAAAGGG
TGCAGCTTCTACAACAAGACGTGTTACTCCGGCTTGGAGATTCATATTTCAAACTCGTACGCAAACTCGCTGCTC
CAGGTGATGAACTTCACACCCCTGGTTCGCAACATGGCTCTCCAGCATGCCGCGACGTCCTGTATCAACGATCTC
TGCCTGTTGTGCGAGCTGGGCTTTCTGTTCGACATGCTGCAGAAAGCTGACGGGTCTATTTGCCAAGCAACCAAT
CTTCTCAGGACGCTCAGCGGTCATCCTCAAGGTGAGCGAGCTCATTGCTAATTCTGGACGTCGTGCTGACAGCCA
TCTAGCCGCTCCGTTGGGACTCCTCGAGGAGGACTCTCACGGGTCGTCGTTGAACCTCATGCTGCAGGGCCTCAC
CCGCTTCCTCCTCGACAAGATTGTGGCTGACTACAAGTGCATGCCTCCGGCGTCTTCGGCTCTGGAACAGGTATG
AGCCCGCCGTCATTTGCGAATCCTGACACTGACGTCTGCCCGACAGGTTCTCGCAACGTCGGCTACAAGCTCCAT
CAGATGCATGAACTGTAGGAGCGAGTACACGAGGCCCGGTTCGACATTCGTGACGGACCTGCTCTACCCTCCCCA
CGTGAGGAAGCCTTGGACTCTCCATGGCTGGCCCGCTGCTAATCGCCGTCGGCAGAAATCGTCGGGCCGCAACAG
CAAAATGCCTCGTTTCACCTTCTCCCAAATTCTGAAGAGCAGCATCGAGAGAGAGACGACATCTAAGGGATGGTG
TGGCCGATGTCAGCGATATCAGACCATTGCGACGAGAAAGACGATCCATAATATACCGGCCGTGCTGATGCTCAA
CACGGCCATCACGAACCAGGATCATCGAATGCTCTGGTCTACTCCCGGGTTTCTCCCGGATGAGATTGGAATCAT
CGTCGACCAAGGCCAGTTTTACTGCTACGAGGGCGAAGACCTCAAGCTCCATCTCCAGCGGGGCATGCACAGCAT
CACCGTCTACTCGCTCATGGGCATGGCCGTGAATATCGAGGGCGGTCAGACGCAGAAGTCCCATCTCGTATCCGT
GGTCAACGGTGAGTTTTTCTCCCCCATAATGGCTTCATCTCTGCTGACATACCGCGGCCAGTTGCCCATTCCGAA
CCTCAGTGGCCGGGACAGAGCCAGTGGCATCTGTTCAATGACTTCTTGGTCCGCTCCATCAGTAGAGAAGAGGCC
CTGACCTTTAACCAATCCTGGAAGACGCCTTCGGTTGTGGCCTTTCAGGTCAAGCACGCCAACAACAAGATGGAC
ACGGAGTGGAAGGACCATCTCGATACATCCATCCTCTATCACGATCTCAGGTAAGCGAGCGGTTTCTTCAACCGT
CCATCGGGACTAACTCGGATGATAGCCCAGGTTTGCATCCCGAAAACCAGACATATCGGATCCTGGACCATGAGA
CGGAGCGCCCCGGGCCGGGGACCATCGTGGCCCTCGACACGGAGTTTGTCGCGGTTCGGCAGCCGGAAATCGAGA
TGAACTCGGACGGAGAGCGGGAGACAATCCGTCCCATTGTCTATGCGCTCGCTCGAGCATCGGTGTTGCGAGGAC
AGGGTGAGAAGGAGGGGACGCCGTTCGTGGACGACTACATTGCCATCAAGGAGCCCATCGTCGACTACCTGACGT
CGTACTCGGGCATCCGGGAGGAGGATCTAGATCCGCGCCTCTCCAAGCACAGTCTCTTGTCGCTCAAGATGGCGT
ACAAGAAGCTCTGGATCCTGCTCAACTTGGGCTGTAGATTCCTCGGACACGGGCTGAAGCAGGACTTTCGCGTCA
TCAACATCCACGTACCCAAGGCGCAAGTCATAGACACCATCGACCTCTTCTATCTCAAGTCACGTCTGCGCAAGC
TATCACTCGCCTTTTTGGCTTGGTACCTCCTCAAAGAGGACATCCAGATGGAGACGCACGACTCCATCGAAGACT
CGCGCACCGCCCTCAGGCTGTATCGCAAATATCTCGAATTCCAAGACGCCGGTGTGCTCGAAGCGATGCTGCAGG
ATATATACCGCGTCGGCCGCGAAGTCAACTTCAAACCACCGCGCGCCGACGTCGAGAGGACCGACACGCCGCCCC
CGTTGCCTGTCGAGGGCTCCGTTCCGGCTACCGACGCCGCCTCCGCCGCCGCCACCGTCGCCGCCACCGTGGCCG
CGCCGACGACGCCCGTGGCCAAGACGGTCGGCCTCGCGTCGTCGGCTTCTGCTCACATTGCCCCGGCGGCTGGCT
TTGGGGGGCCGTCTTGGACGCCGGGCAAGGGGTCGCCTATGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail