Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01141
Gene name
Locationscaffold_01:4168491..4172513
Strand+
Gene length (bp)4022
Transcript length (bp)3399
Coding sequence length (bp)3399
Protein length (aa) 1133

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 9.5E-103 463 776
PF00929 RNase_T Exonuclease 1.5E-21 852 1025

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6912 0.4999 0.1037 0.0666 0.0722 0.0078 0.2254 0.1101 0.2384 0.0089

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 3 (None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4736
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|113
Ophiocordyceps australis map64 (Brazil) OphauB2|7026
Ophiocordyceps camponoti-floridani Ophcf2|01141 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5705
Ophiocordyceps kimflemingae Ophio5|1746
Ophiocordyceps subramaniannii Hirsu2|9998

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01141
MDGDWDEVSRIPFPSSGVHAMPTPVTTMTFDTSQELLWTGNDYGRVMSFLGTEQQRYTSFKAHQAIDGPVRQILV
NDKGVIALGSRDIHMALRRGPPIWHIRHDEMSELRCMTFTSKGASEILVAGLQNKMLVIDINKGEVIEQLHSEYH
YTAMKRGRYICAATKHGAVHLLDPANFSVVRIWNAHSALVNDIDAQHDFIVTCGYSLRQGQNYMLDPFLNVFDIK
KMSSMAPIPFPAGAAYVRMHPRMLTTSIVVSQTGQMHVVDLMNPNTSNVRQANVLSYLSMFEIAPSGEAMALADA
ECFIHLWGSPSKLHFVDLPAPVEFATPEEPMPPIDWTSETPLNSVGLPYYREVLASAMPDTVSDVGAPPPIRCSV
ENTRNVNRSASAGLKAPKFLSEKARESAKSDVKSADDKTDDLTSPTGETISGHKKSDVPMMYRNVEIKYSKFGVD
DFDFGFYNKTCYSGLEIHISNSYANSLLQVMNFTPLVRNMALQHAATSCINDLCLLCELGFLFDMLQKADGSICQ
ATNLLRTLSGHPQAAPLGLLEEDSHGSSLNLMLQGLTRFLLDKIVADYKCMPPASSALEQVLATSATSSIRCMNC
RSEYTRPGSTFVTDLLYPPHKSSGRNSKMPRFTFSQILKSSIERETTSKGWCGRCQRYQTIATRKTIHNIPAVLM
LNTAITNQDHRMLWSTPGFLPDEIGIIVDQGQFYCYEGEDLKLHLQRGMHSITVYSLMGMAVNIEGGQTQKSHLV
SVVNVAHSEPQWPGQSQWHLFNDFLVRSISREEALTFNQSWKTPSVVAFQVKHANNKMDTEWKDHLDTSILYHDL
SPGLHPENQTYRILDHETERPGPGTIVALDTEFVAVRQPEIEMNSDGERETIRPIVYALARASVLRGQGEKEGTP
FVDDYIAIKEPIVDYLTSYSGIREEDLDPRLSKHSLLSLKMAYKKLWILLNLGCRFLGHGLKQDFRVINIHVPKA
QVIDTIDLFYLKSRLRKLSLAFLAWYLLKEDIQMETHDSIEDSRTALRLYRKYLEFQDAGVLEAMLQDIYRVGRE
VNFKPPRADVERTDTPPPLPVEGSVPATDAASAAATVAATVAAPTTPVAKTVGLASSASAHIAPAAGFGGPSWTP
GKGSPMK*
Coding >Ophcf2|01141
ATGGATGGAGACTGGGATGAGGTTTCCCGCATTCCCTTTCCGTCCTCGGGCGTACACGCGATGCCCACGCCCGTG
ACTACCATGACGTTTGACACCTCGCAGGAGCTGCTCTGGACTGGAAACGACTACGGACGCGTCATGTCCTTTCTC
GGAACCGAGCAGCAGAGGTACACGTCGTTCAAGGCCCATCAGGCCATAGATGGACCTGTACGACAGATCCTGGTC
AACGACAAGGGCGTGATAGCACTGGGCTCAAGAGACATACATATGGCCTTGAGAAGAGGACCCCCGATTTGGCAC
ATCAGGCACGATGAGATGAGCGAGCTGCGGTGCATGACCTTCACCTCGAAAGGAGCTTCGGAGATTCTCGTTGCT
GGACTACAGAACAAGATGCTCGTCATCGACATCAACAAGGGCGAGGTCATCGAGCAGCTGCATAGCGAGTACCAT
TATACAGCCATGAAGCGAGGCCGTTACATCTGCGCCGCCACCAAGCACGGAGCTGTCCATCTCCTGGACCCTGCC
AACTTTTCCGTCGTTAGAATCTGGAACGCACATTCGGCGCTGGTCAACGACATTGACGCGCAACACGACTTCATC
GTCACTTGCGGGTATTCCTTGCGGCAGGGACAGAACTACATGCTGGATCCGTTCCTCAACGTCTTCGACATCAAG
AAAATGTCCTCGATGGCCCCTATACCTTTCCCGGCAGGGGCGGCCTACGTGCGAATGCACCCGCGCATGCTCACC
ACCAGCATTGTCGTGTCCCAGACCGGTCAGATGCATGTCGTGGACCTTATGAATCCAAACACGAGCAATGTCCGA
CAAGCCAACGTCCTCTCCTATCTGAGTATGTTTGAGATTGCTCCTTCGGGCGAAGCCATGGCGCTCGCCGATGCC
GAGTGCTTCATCCATCTATGGGGCTCACCTTCAAAGTTGCATTTCGTCGACCTGCCGGCTCCGGTGGAGTTTGCA
ACTCCCGAGGAACCAATGCCGCCTATCGACTGGACGTCCGAGACACCCTTGAACTCGGTAGGTCTGCCGTACTAT
CGAGAGGTTCTGGCGTCGGCAATGCCCGACACCGTCTCCGACGTCGGCGCCCCCCCCCCGATTCGATGTTCAGTC
GAGAACACGCGCAACGTCAACAGGTCCGCCAGCGCCGGACTGAAGGCCCCCAAGTTTCTGAGCGAGAAGGCTCGT
GAGTCTGCTAAGAGCGACGTCAAGAGCGCCGACGATAAGACGGACGACCTCACCAGTCCCACGGGGGAAACCATA
TCCGGACATAAGAAATCCGACGTGCCAATGATGTACAGAAACGTGGAGATCAAGTACAGCAAGTTCGGCGTCGAC
GACTTTGATTTTGGCTTCTACAACAAGACGTGTTACTCCGGCTTGGAGATTCATATTTCAAACTCGTACGCAAAC
TCGCTGCTCCAGGTGATGAACTTCACACCCCTGGTTCGCAACATGGCTCTCCAGCATGCCGCGACGTCCTGTATC
AACGATCTCTGCCTGTTGTGCGAGCTGGGCTTTCTGTTCGACATGCTGCAGAAAGCTGACGGGTCTATTTGCCAA
GCAACCAATCTTCTCAGGACGCTCAGCGGTCATCCTCAAGCCGCTCCGTTGGGACTCCTCGAGGAGGACTCTCAC
GGGTCGTCGTTGAACCTCATGCTGCAGGGCCTCACCCGCTTCCTCCTCGACAAGATTGTGGCTGACTACAAGTGC
ATGCCTCCGGCGTCTTCGGCTCTGGAACAGGTTCTCGCAACGTCGGCTACAAGCTCCATCAGATGCATGAACTGT
AGGAGCGAGTACACGAGGCCCGGTTCGACATTCGTGACGGACCTGCTCTACCCTCCCCACAAATCGTCGGGCCGC
AACAGCAAAATGCCTCGTTTCACCTTCTCCCAAATTCTGAAGAGCAGCATCGAGAGAGAGACGACATCTAAGGGA
TGGTGTGGCCGATGTCAGCGATATCAGACCATTGCGACGAGAAAGACGATCCATAATATACCGGCCGTGCTGATG
CTCAACACGGCCATCACGAACCAGGATCATCGAATGCTCTGGTCTACTCCCGGGTTTCTCCCGGATGAGATTGGA
ATCATCGTCGACCAAGGCCAGTTTTACTGCTACGAGGGCGAAGACCTCAAGCTCCATCTCCAGCGGGGCATGCAC
AGCATCACCGTCTACTCGCTCATGGGCATGGCCGTGAATATCGAGGGCGGTCAGACGCAGAAGTCCCATCTCGTA
TCCGTGGTCAACGTTGCCCATTCCGAACCTCAGTGGCCGGGACAGAGCCAGTGGCATCTGTTCAATGACTTCTTG
GTCCGCTCCATCAGTAGAGAAGAGGCCCTGACCTTTAACCAATCCTGGAAGACGCCTTCGGTTGTGGCCTTTCAG
GTCAAGCACGCCAACAACAAGATGGACACGGAGTGGAAGGACCATCTCGATACATCCATCCTCTATCACGATCTC
AGCCCAGGTTTGCATCCCGAAAACCAGACATATCGGATCCTGGACCATGAGACGGAGCGCCCCGGGCCGGGGACC
ATCGTGGCCCTCGACACGGAGTTTGTCGCGGTTCGGCAGCCGGAAATCGAGATGAACTCGGACGGAGAGCGGGAG
ACAATCCGTCCCATTGTCTATGCGCTCGCTCGAGCATCGGTGTTGCGAGGACAGGGTGAGAAGGAGGGGACGCCG
TTCGTGGACGACTACATTGCCATCAAGGAGCCCATCGTCGACTACCTGACGTCGTACTCGGGCATCCGGGAGGAG
GATCTAGATCCGCGCCTCTCCAAGCACAGTCTCTTGTCGCTCAAGATGGCGTACAAGAAGCTCTGGATCCTGCTC
AACTTGGGCTGTAGATTCCTCGGACACGGGCTGAAGCAGGACTTTCGCGTCATCAACATCCACGTACCCAAGGCG
CAAGTCATAGACACCATCGACCTCTTCTATCTCAAGTCACGTCTGCGCAAGCTATCACTCGCCTTTTTGGCTTGG
TACCTCCTCAAAGAGGACATCCAGATGGAGACGCACGACTCCATCGAAGACTCGCGCACCGCCCTCAGGCTGTAT
CGCAAATATCTCGAATTCCAAGACGCCGGTGTGCTCGAAGCGATGCTGCAGGATATATACCGCGTCGGCCGCGAA
GTCAACTTCAAACCACCGCGCGCCGACGTCGAGAGGACCGACACGCCGCCCCCGTTGCCTGTCGAGGGCTCCGTT
CCGGCTACCGACGCCGCCTCCGCCGCCGCCACCGTCGCCGCCACCGTGGCCGCGCCGACGACGCCCGTGGCCAAG
ACGGTCGGCCTCGCGTCGTCGGCTTCTGCTCACATTGCCCCGGCGGCTGGCTTTGGGGGGCCGTCTTGGACGCCG
GGCAAGGGGTCGCCTATGAAGTAA
Transcript >Ophcf2|01141
ATGGATGGAGACTGGGATGAGGTTTCCCGCATTCCCTTTCCGTCCTCGGGCGTACACGCGATGCCCACGCCCGTG
ACTACCATGACGTTTGACACCTCGCAGGAGCTGCTCTGGACTGGAAACGACTACGGACGCGTCATGTCCTTTCTC
GGAACCGAGCAGCAGAGGTACACGTCGTTCAAGGCCCATCAGGCCATAGATGGACCTGTACGACAGATCCTGGTC
AACGACAAGGGCGTGATAGCACTGGGCTCAAGAGACATACATATGGCCTTGAGAAGAGGACCCCCGATTTGGCAC
ATCAGGCACGATGAGATGAGCGAGCTGCGGTGCATGACCTTCACCTCGAAAGGAGCTTCGGAGATTCTCGTTGCT
GGACTACAGAACAAGATGCTCGTCATCGACATCAACAAGGGCGAGGTCATCGAGCAGCTGCATAGCGAGTACCAT
TATACAGCCATGAAGCGAGGCCGTTACATCTGCGCCGCCACCAAGCACGGAGCTGTCCATCTCCTGGACCCTGCC
AACTTTTCCGTCGTTAGAATCTGGAACGCACATTCGGCGCTGGTCAACGACATTGACGCGCAACACGACTTCATC
GTCACTTGCGGGTATTCCTTGCGGCAGGGACAGAACTACATGCTGGATCCGTTCCTCAACGTCTTCGACATCAAG
AAAATGTCCTCGATGGCCCCTATACCTTTCCCGGCAGGGGCGGCCTACGTGCGAATGCACCCGCGCATGCTCACC
ACCAGCATTGTCGTGTCCCAGACCGGTCAGATGCATGTCGTGGACCTTATGAATCCAAACACGAGCAATGTCCGA
CAAGCCAACGTCCTCTCCTATCTGAGTATGTTTGAGATTGCTCCTTCGGGCGAAGCCATGGCGCTCGCCGATGCC
GAGTGCTTCATCCATCTATGGGGCTCACCTTCAAAGTTGCATTTCGTCGACCTGCCGGCTCCGGTGGAGTTTGCA
ACTCCCGAGGAACCAATGCCGCCTATCGACTGGACGTCCGAGACACCCTTGAACTCGGTAGGTCTGCCGTACTAT
CGAGAGGTTCTGGCGTCGGCAATGCCCGACACCGTCTCCGACGTCGGCGCCCCCCCCCCGATTCGATGTTCAGTC
GAGAACACGCGCAACGTCAACAGGTCCGCCAGCGCCGGACTGAAGGCCCCCAAGTTTCTGAGCGAGAAGGCTCGT
GAGTCTGCTAAGAGCGACGTCAAGAGCGCCGACGATAAGACGGACGACCTCACCAGTCCCACGGGGGAAACCATA
TCCGGACATAAGAAATCCGACGTGCCAATGATGTACAGAAACGTGGAGATCAAGTACAGCAAGTTCGGCGTCGAC
GACTTTGATTTTGGCTTCTACAACAAGACGTGTTACTCCGGCTTGGAGATTCATATTTCAAACTCGTACGCAAAC
TCGCTGCTCCAGGTGATGAACTTCACACCCCTGGTTCGCAACATGGCTCTCCAGCATGCCGCGACGTCCTGTATC
AACGATCTCTGCCTGTTGTGCGAGCTGGGCTTTCTGTTCGACATGCTGCAGAAAGCTGACGGGTCTATTTGCCAA
GCAACCAATCTTCTCAGGACGCTCAGCGGTCATCCTCAAGCCGCTCCGTTGGGACTCCTCGAGGAGGACTCTCAC
GGGTCGTCGTTGAACCTCATGCTGCAGGGCCTCACCCGCTTCCTCCTCGACAAGATTGTGGCTGACTACAAGTGC
ATGCCTCCGGCGTCTTCGGCTCTGGAACAGGTTCTCGCAACGTCGGCTACAAGCTCCATCAGATGCATGAACTGT
AGGAGCGAGTACACGAGGCCCGGTTCGACATTCGTGACGGACCTGCTCTACCCTCCCCACAAATCGTCGGGCCGC
AACAGCAAAATGCCTCGTTTCACCTTCTCCCAAATTCTGAAGAGCAGCATCGAGAGAGAGACGACATCTAAGGGA
TGGTGTGGCCGATGTCAGCGATATCAGACCATTGCGACGAGAAAGACGATCCATAATATACCGGCCGTGCTGATG
CTCAACACGGCCATCACGAACCAGGATCATCGAATGCTCTGGTCTACTCCCGGGTTTCTCCCGGATGAGATTGGA
ATCATCGTCGACCAAGGCCAGTTTTACTGCTACGAGGGCGAAGACCTCAAGCTCCATCTCCAGCGGGGCATGCAC
AGCATCACCGTCTACTCGCTCATGGGCATGGCCGTGAATATCGAGGGCGGTCAGACGCAGAAGTCCCATCTCGTA
TCCGTGGTCAACGTTGCCCATTCCGAACCTCAGTGGCCGGGACAGAGCCAGTGGCATCTGTTCAATGACTTCTTG
GTCCGCTCCATCAGTAGAGAAGAGGCCCTGACCTTTAACCAATCCTGGAAGACGCCTTCGGTTGTGGCCTTTCAG
GTCAAGCACGCCAACAACAAGATGGACACGGAGTGGAAGGACCATCTCGATACATCCATCCTCTATCACGATCTC
AGCCCAGGTTTGCATCCCGAAAACCAGACATATCGGATCCTGGACCATGAGACGGAGCGCCCCGGGCCGGGGACC
ATCGTGGCCCTCGACACGGAGTTTGTCGCGGTTCGGCAGCCGGAAATCGAGATGAACTCGGACGGAGAGCGGGAG
ACAATCCGTCCCATTGTCTATGCGCTCGCTCGAGCATCGGTGTTGCGAGGACAGGGTGAGAAGGAGGGGACGCCG
TTCGTGGACGACTACATTGCCATCAAGGAGCCCATCGTCGACTACCTGACGTCGTACTCGGGCATCCGGGAGGAG
GATCTAGATCCGCGCCTCTCCAAGCACAGTCTCTTGTCGCTCAAGATGGCGTACAAGAAGCTCTGGATCCTGCTC
AACTTGGGCTGTAGATTCCTCGGACACGGGCTGAAGCAGGACTTTCGCGTCATCAACATCCACGTACCCAAGGCG
CAAGTCATAGACACCATCGACCTCTTCTATCTCAAGTCACGTCTGCGCAAGCTATCACTCGCCTTTTTGGCTTGG
TACCTCCTCAAAGAGGACATCCAGATGGAGACGCACGACTCCATCGAAGACTCGCGCACCGCCCTCAGGCTGTAT
CGCAAATATCTCGAATTCCAAGACGCCGGTGTGCTCGAAGCGATGCTGCAGGATATATACCGCGTCGGCCGCGAA
GTCAACTTCAAACCACCGCGCGCCGACGTCGAGAGGACCGACACGCCGCCCCCGTTGCCTGTCGAGGGCTCCGTT
CCGGCTACCGACGCCGCCTCCGCCGCCGCCACCGTCGCCGCCACCGTGGCCGCGCCGACGACGCCCGTGGCCAAG
ACGGTCGGCCTCGCGTCGTCGGCTTCTGCTCACATTGCCCCGGCGGCTGGCTTTGGGGGGCCGTCTTGGACGCCG
GGCAAGGGGTCGCCTATGAAGTAA
Gene >Ophcf2|01141
ATGGATGGAGACTGGGATGAGGTTCGTCGTCTATCCACGCCGTCTGCCGTTTGTGCCGACGCGCTTCATGAAGCC
TGCTGATGCATCGTGTTTCCAGGTTTCCCGCATTCCCTTTCCGTCCTCGGGCGTACACGCGATGCCCACGCCCGT
GACTACCATGACGTTTGACACCTCGCAGGAGCTGCTCTGGACTGGAAACGACTACGTACGCAAAATCCCTTCTAG
CCTCCCTTGTTATGTGACTGACAGCTCGGATAGGGACGCGTCATGTCCTTTCTCGGAACCGAGCAGCAGAGGTAC
ACGTCGTTCAAGGCCCATCAGGCCATAGATGGACCTGTACGACAGATCCTGGTCAACGACAAGGGCGTGATAGCA
CTGGGCTCAAGAGACATACATATGGCCTTGAGAAGAGGACCCCCGATTTGGCACATCAGGTATGTCTTTTCCACC
GGTCCCGCAAAACGTAATCTAATCATGCGTTCTTTAGGCACGATGAGATGAGCGAGCTGCGGTGCATGACCTTCA
CCTCGAAAGGAGCTTCGGAGATTCTCGTTGCTGGACTACAGAACAAGATGCTCGTCATCGACATCAACAAGGGCG
AGGTCATCGAGCAGCTGCATAGCGAGTACCATTATACAGCCATGAAGCGAGGCCGTTACATCTGCGCCGCCACCA
AGCACGGAGCTGTCCATCTCCTGGACCCTGCCAACTTTTCCGTCGTTAGAATCTGGAACGCACATTCGGCGCTGG
TCAACGACATTGACGCGCAACACGACTTCATCGTCACTTGCGGGTATTCCTTGCGGCAGGGACAGAACTACATGC
TGGATCCGTTCCTCAACGTCTTCGACATCAAGAAAATGTCCTCGATGGCCCCTATACCTTTCCCGGCAGGGGCGG
CCTACGTGCGAATGCACCCGCGCATGCTCACCACCAGCATTGTCGTGTCCCAGACCGGTCAGATGCATGTCGTGG
ACCTTATGAATCCAAACACGAGCAATGTCCGACAAGCCAACGTCCTCTCCTATCTGAGTATGTTTGAGATTGCTC
CTTCGGGCGAAGCCATGGCGCTCGCCGATGCCGAGTGCTTCATCCATCTATGGGGCTCACCTTCAAAGTTGCATT
TCGTCGACCTGCCGGCTCCGGTGGAGTTTGCAACTCCCGAGGAACCAATGCCGCCTATCGACTGGACGTCCGAGA
CGTAAGATGAACCCCTCCCCGTCGTTTCGACGACGACAAAGACTGACATGGCTTATAGACCCTTGAACTCGGTAG
GTCTGCCGTACTATCGAGAGGTTCTGGCGTCGGCAATGCCCGACACCGTCTCCGACGTCGGCGCCCCCCCCCCGA
TTCGATGTTCAGTTCGTCAACAGCCTAAAGGCGGCCGATTTTGGTATGTATGGCCGAAACACCCGTGGCGTCCGA
CGAAATCAGGTCGAGAACACGCGCAACGTCAACAGGTCCGCCAGCGCCGGACTGAAGGCCCCCAAGTTTCTGAGC
GAGAAGGCTCGTGAGTCTGCTAAGAGCGACGTCAAGAGCGCCGACGATAAGACGGACGACCTCACCAGTCCCACG
GGGGAAACCATATCCGGACATAAGAAATCCGACGTGCCAATGATGTACAGAAACGTGGAGATCAAGTACAGCAAG
TTCGGCGTCGACGACTTTGATTTTGGGTACGTCCATTCCCGACTTCTGCGCAAGGACAGACTGCTAAGAAAAGGG
TGCAGCTTCTACAACAAGACGTGTTACTCCGGCTTGGAGATTCATATTTCAAACTCGTACGCAAACTCGCTGCTC
CAGGTGATGAACTTCACACCCCTGGTTCGCAACATGGCTCTCCAGCATGCCGCGACGTCCTGTATCAACGATCTC
TGCCTGTTGTGCGAGCTGGGCTTTCTGTTCGACATGCTGCAGAAAGCTGACGGGTCTATTTGCCAAGCAACCAAT
CTTCTCAGGACGCTCAGCGGTCATCCTCAAGGTGAGCGAGCTCATTGCTAATTCTGGACGTCGTGCTGACAGCCA
TCTAGCCGCTCCGTTGGGACTCCTCGAGGAGGACTCTCACGGGTCGTCGTTGAACCTCATGCTGCAGGGCCTCAC
CCGCTTCCTCCTCGACAAGATTGTGGCTGACTACAAGTGCATGCCTCCGGCGTCTTCGGCTCTGGAACAGGTATG
AGCCCGCCGTCATTTGCGAATCCTGACACTGACGTCTGCCCGACAGGTTCTCGCAACGTCGGCTACAAGCTCCAT
CAGATGCATGAACTGTAGGAGCGAGTACACGAGGCCCGGTTCGACATTCGTGACGGACCTGCTCTACCCTCCCCA
CGTGAGGAAGCCTTGGACTCTCCATGGCTGGCCCGCTGCTAATCGCCGTCGGCAGAAATCGTCGGGCCGCAACAG
CAAAATGCCTCGTTTCACCTTCTCCCAAATTCTGAAGAGCAGCATCGAGAGAGAGACGACATCTAAGGGATGGTG
TGGCCGATGTCAGCGATATCAGACCATTGCGACGAGAAAGACGATCCATAATATACCGGCCGTGCTGATGCTCAA
CACGGCCATCACGAACCAGGATCATCGAATGCTCTGGTCTACTCCCGGGTTTCTCCCGGATGAGATTGGAATCAT
CGTCGACCAAGGCCAGTTTTACTGCTACGAGGGCGAAGACCTCAAGCTCCATCTCCAGCGGGGCATGCACAGCAT
CACCGTCTACTCGCTCATGGGCATGGCCGTGAATATCGAGGGCGGTCAGACGCAGAAGTCCCATCTCGTATCCGT
GGTCAACGGTGAGTTTTTCTCCCCCATAATGGCTTCATCTCTGCTGACATACCGCGGCCAGTTGCCCATTCCGAA
CCTCAGTGGCCGGGACAGAGCCAGTGGCATCTGTTCAATGACTTCTTGGTCCGCTCCATCAGTAGAGAAGAGGCC
CTGACCTTTAACCAATCCTGGAAGACGCCTTCGGTTGTGGCCTTTCAGGTCAAGCACGCCAACAACAAGATGGAC
ACGGAGTGGAAGGACCATCTCGATACATCCATCCTCTATCACGATCTCAGGTAAGCGAGCGGTTTCTTCAACCGT
CCATCGGGACTAACTCGGATGATAGCCCAGGTTTGCATCCCGAAAACCAGACATATCGGATCCTGGACCATGAGA
CGGAGCGCCCCGGGCCGGGGACCATCGTGGCCCTCGACACGGAGTTTGTCGCGGTTCGGCAGCCGGAAATCGAGA
TGAACTCGGACGGAGAGCGGGAGACAATCCGTCCCATTGTCTATGCGCTCGCTCGAGCATCGGTGTTGCGAGGAC
AGGGTGAGAAGGAGGGGACGCCGTTCGTGGACGACTACATTGCCATCAAGGAGCCCATCGTCGACTACCTGACGT
CGTACTCGGGCATCCGGGAGGAGGATCTAGATCCGCGCCTCTCCAAGCACAGTCTCTTGTCGCTCAAGATGGCGT
ACAAGAAGCTCTGGATCCTGCTCAACTTGGGCTGTAGATTCCTCGGACACGGGCTGAAGCAGGACTTTCGCGTCA
TCAACATCCACGTACCCAAGGCGCAAGTCATAGACACCATCGACCTCTTCTATCTCAAGTCACGTCTGCGCAAGC
TATCACTCGCCTTTTTGGCTTGGTACCTCCTCAAAGAGGACATCCAGATGGAGACGCACGACTCCATCGAAGACT
CGCGCACCGCCCTCAGGCTGTATCGCAAATATCTCGAATTCCAAGACGCCGGTGTGCTCGAAGCGATGCTGCAGG
ATATATACCGCGTCGGCCGCGAAGTCAACTTCAAACCACCGCGCGCCGACGTCGAGAGGACCGACACGCCGCCCC
CGTTGCCTGTCGAGGGCTCCGTTCCGGCTACCGACGCCGCCTCCGCCGCCGCCACCGTCGCCGCCACCGTGGCCG
CGCCGACGACGCCCGTGGCCAAGACGGTCGGCCTCGCGTCGTCGGCTTCTGCTCACATTGCCCCGGCGGCTGGCT
TTGGGGGGCCGTCTTGGACGCCGGGCAAGGGGTCGCCTATGAAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail