Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01137
Gene name
Locationscaffold_01:4149125..4153545
Strand-
Gene length (bp)4420
Transcript length (bp)4299
Coding sequence length (bp)4299
Protein length (aa) 1433

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00360 PHY Phytochrome region 6.2E-29 640 806
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 3.1E-19 941 1066
PF00072 Response_reg Response regulator receiver domain 1.4E-15 1257 1382
PF00512 HisKA His Kinase A (phospho-acceptor) domain 5.5E-12 832 894
PF01590 GAF GAF domain 5.1E-11 461 621
PF08446 PAS_2 PAS fold 3.7E-09 260 333

GO

GO Term Description Terminal node
GO:0018298 obsolete protein-chromophore linkage Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0009584 detection of visible light Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0005515 protein binding Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0007165 signal transduction Yes
GO:0005488 binding No
GO:0031323 regulation of cellular metabolic process No
GO:0003824 catalytic activity No
GO:0009605 response to external stimulus No
GO:0140299 small molecule sensor activity No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0016301 kinase activity No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0140096 catalytic activity, acting on a protein No
GO:0004672 protein kinase activity No
GO:0016740 transferase activity No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:0051606 detection of stimulus No
GO:0009987 cellular process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0080090 regulation of primary metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0050794 regulation of cellular process No
GO:2001141 regulation of RNA biosynthetic process No
GO:0009314 response to radiation No
GO:0009416 response to light stimulus No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0009583 detection of light stimulus No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0065007 biological regulation No
GO:0004673 protein histidine kinase activity No
GO:0019222 regulation of metabolic process No
GO:0009581 detection of external stimulus No
GO:0051252 regulation of RNA metabolic process No
GO:0009628 response to abiotic stimulus No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0009582 detection of abiotic stimulus No
GO:0003674 molecular_function No
GO:0035556 intracellular signal transduction No
GO:0050896 response to stimulus No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6641 0.4194 0.0515 0.1831 0.1403 0.0125 0.1366 0.1092 0.058 0.031

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup935
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|109
Ophiocordyceps australis map64 (Brazil) OphauB2|7022
Ophiocordyceps camponoti-floridani Ophcf2|01137 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5953
Ophiocordyceps kimflemingae Ophio5|4324
Ophiocordyceps subramaniannii Hirsu2|679

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01137
MDDRQQPDVDGDDFGATPRRGTRSSPFSPEASSPFPSFVQSPDAAQGVISPDPVSSSWSTSSEKHMCTRSAASDI
SVDRVFPIRSVITVAPTPRRPSNSVDDYFTLRSDETGAQTRSRWRDRRPAALSADLRRVDSTPLPAHPLSASEAS
PGAQPSWSRRKRPLSGPLSSIQADAARKGTIGPLNLAMASASDDGSDDSAAIRPPRSSARIPGPIRGSASAASGR
QSLSDMPHVTTRFTHVQTEGGHAVITGRDGVLQRCEDEPIHTPGAVQGFGILIALREENDGSFIVRYASENSDKM
LGYSPKQLFQLTNFMDILTEEQQDNLLDHIDFIRDEDADPSANGPEVLSLSVRHPKRRRSVKLWCAIHINPAHPD
LIICEFERDDDQEFPLRPTDELTPDAPHDTLHSNPNLEEIEESTEVLSKPLRILRSARKRRGEQGAMQVFDIMSQ
VQEQLASASNLDNFLKILVGIFKELTGFHRVMVYQFDSSFNGKVVTELVDTSQTLDLYKGLNFPASDIPRQARDL
YRINKVRLLYDRDLETARIVCRSAEDLEMPLDMTHAYLRAMSPIHLKYLGNMAVRSSMSISINAFDELWGLIACH
SYGPHGMRVSFPIRKMCRLVGDTASRNIERLSYASRLQARKLINTAPTDNNPTGYIIASSDDLLKLFDADFGLLS
IRGETKVLGTLEHSQEALAMLEYLRMRRLTAVLTSQDIAEDFPDLLYPPGFQVIAGLLYVPLSVGGHDFIVFFRR
GQVREVKWAGNPYEKTIRQGTSGYLEPRSSFKTWRETVIGKCREWNEEQVETAAVLCLVYGKFIEVWRQKEAALQ
NSKLTRLLLANSAHEVRTPLNAIINYLEIALEGSLDQETRDNLARSHSASKSLIYVINDLLDLTKTEEGQNLIKD
EVFDLVACLEEATEPFHIDAKRKGIGLGVRHNPGVPRRVHGDGRRVRQAISNVTANAVAHTQTGSVDVEMAVVEL
RDGQAIVEITVTDSGIGMSPQQLDALFRELEQVSSEEPEPEPKSPTDQAQGGRTLGLGLALVARIVRNMDGQLRL
KSEEGQGSRFVVQLPFLLADDSPGDNREMEATMTASTAGSIKAAPPPDGEILLIDGGRVCVEGSAVMAPDDNSVG
SRHSLRSRASLGSDADRLINAIQTPLSLNDNNQTGYFGHVPDSSCSSDRRPSGTSLTVAGPLPTSPTPGRKLALL
PRHEPGTEEIRDSKTPLRAVKVPDEYKKMPRIVQELPEPAEKDGKKETTTDVGLRTLVAEDDPINMKVLSKRLEK
AGHEVRHAVNGEDCATVYKGDSSSFDVILMDMQMPIVDGLTSTKMIRSIESTAEHKGYSRLATSNGRVPIFAVSA
SLVEREKQVYIDAGFDGWILKPIDFKRLNTLLQGIRDGQTRSTCLYVEGEWERGGWFVMPPDASSCVTASDDTTP
RAEETTC*
Coding >Ophcf2|01137
ATGGACGACAGGCAGCAGCCAGACGTCGACGGTGATGATTTTGGCGCCACGCCGCGACGGGGCACTCGATCCAGT
CCCTTCAGCCCCGAGGCATCGTCGCCCTTCCCGTCCTTTGTCCAGTCGCCAGACGCTGCCCAGGGCGTCATCAGC
CCCGATCCCGTCTCGTCGTCGTGGAGCACAAGCTCTGAGAAGCACATGTGCACCCGCTCCGCCGCCTCGGACATC
TCGGTCGACCGCGTTTTCCCCATCAGGTCCGTCATCACCGTCGCTCCCACTCCGCGCCGCCCTTCAAACTCTGTC
GACGACTACTTTACCCTTCGATCCGACGAAACGGGTGCCCAGACTCGCAGCCGTTGGCGCGACCGTCGACCGGCT
GCCCTCTCGGCAGACCTGCGAAGGGTCGACTCTACCCCCTTGCCCGCTCACCCGCTGTCGGCCTCTGAGGCGAGC
CCTGGCGCCCAGCCCTCCTGGTCGCGCCGCAAGAGGCCTCTGAGTGGTCCCTTGTCCAGCATCCAGGCCGACGCC
GCTCGCAAGGGCACCATCGGTCCGCTGAACCTGGCCATGGCCTCCGCCTCGGACGACGGCTCCGACGACTCGGCC
GCCATAAGGCCGCCCCGATCCTCGGCCAGGATTCCCGGTCCCATCCGCGGGAGCGCGTCAGCCGCCTCGGGTCGG
CAGTCCTTGTCCGACATGCCGCACGTCACGACGCGCTTCACCCACGTGCAGACCGAGGGCGGTCACGCCGTCATC
ACCGGCCGCGACGGCGTCCTCCAGCGCTGCGAAGACGAGCCCATCCACACGCCTGGCGCCGTCCAGGGCTTTGGC
ATCCTCATCGCCCTCCGCGAGGAAAACGACGGCAGCTTCATTGTGCGATACGCGAGCGAAAATTCGGACAAGATG
CTCGGCTACAGCCCCAAGCAGCTCTTTCAGCTCACCAACTTCATGGATATCCTGACCGAGGAGCAGCAGGACAAC
CTGCTCGACCACATCGACTTCATCCGCGACGAGGACGCCGACCCGTCCGCTAACGGCCCCGAGGTCCTCAGCCTC
TCGGTCCGGCACCCCAAGAGGAGGCGGAGCGTCAAGCTCTGGTGCGCCATCCACATCAACCCTGCCCATCCCGAC
CTCATCATCTGCGAGTTCGAGCGCGACGACGACCAGGAGTTCCCGCTCCGTCCCACCGACGAGCTGACGCCCGAC
GCCCCCCACGACACGCTGCACTCCAACCCCAACCTCGAGGAGATTGAGGAGAGCACCGAGGTGCTGAGCAAGCCG
CTGCGCATCTTGCGGAGCGCACGCAAGCGAAGGGGCGAGCAGGGCGCCATGCAGGTCTTTGACATCATGTCTCAG
GTCCAGGAGCAGCTGGCCTCGGCTTCCAACCTCGACAACTTTCTCAAGATCCTCGTCGGCATCTTCAAGGAGCTG
ACGGGCTTCCACCGCGTCATGGTTTACCAGTTCGACTCCTCCTTCAACGGCAAGGTCGTCACCGAACTCGTCGAC
ACCTCGCAGACGCTCGACCTCTACAAGGGCCTCAACTTTCCGGCCTCGGACATCCCTCGGCAGGCCCGTGACCTG
TATAGGATCAACAAGGTCCGGCTCCTGTACGATCGCGATCTCGAGACGGCACGCATCGTCTGCCGCTCGGCCGAG
GACCTCGAGATGCCGCTCGACATGACGCACGCCTACCTCCGCGCCATGTCGCCCATCCACCTCAAGTATCTCGGC
AACATGGCCGTTCGTTCCTCCATGTCCATCTCCATCAACGCCTTTGACGAGCTGTGGGGGCTCATCGCCTGCCAC
TCGTACGGCCCCCACGGGATGCGCGTCTCGTTTCCGATACGCAAGATGTGCCGCCTGGTGGGAGACACGGCCTCG
CGAAACATCGAGAGGCTGTCGTACGCCTCGAGGCTGCAGGCGCGGAAGCTCATCAACACGGCGCCGACGGATAAC
AACCCGACCGGTTACATCATAGCCTCGTCCGACGATCTTCTCAAGCTCTTCGACGCCGACTTCGGCCTGCTGTCC
ATCCGGGGCGAGACCAAGGTGCTGGGCACGCTGGAGCACAGTCAGGAGGCGCTGGCCATGCTAGAGTATCTCCGG
ATGCGGAGGCTGACGGCCGTGCTGACGTCTCAGGACATTGCCGAGGACTTTCCCGACCTCCTGTACCCGCCGGGC
TTTCAGGTCATCGCCGGCCTGCTGTACGTGCCCCTGAGCGTCGGCGGCCATGACTTCATCGTCTTCTTCCGCAGG
GGCCAGGTGAGAGAGGTCAAGTGGGCTGGCAACCCGTACGAGAAGACCATCAGGCAGGGGACGTCGGGCTACCTC
GAGCCGCGCAGCAGCTTCAAGACGTGGCGGGAGACGGTCATTGGCAAGTGTCGGGAGTGGAACGAGGAGCAGGTC
GAGACGGCCGCGGTGCTGTGTCTGGTATACGGCAAATTCATCGAGGTCTGGAGACAAAAGGAGGCGGCGCTGCAG
AACAGCAAGCTGACGCGGCTGCTGCTGGCCAACTCGGCTCACGAAGTACGGACGCCGCTCAACGCCATCATCAAC
TACCTGGAGATTGCGCTCGAAGGCTCGCTGGACCAGGAGACTCGCGACAACCTGGCGCGGTCGCACTCGGCTTCC
AAGTCCCTCATCTACGTCATCAACGACCTCCTCGATCTGACCAAGACGGAGGAGGGTCAGAACCTGATCAAGGAC
GAGGTCTTCGACTTGGTGGCCTGCCTGGAAGAAGCGACGGAGCCCTTCCACATCGACGCCAAGCGCAAGGGCATC
GGCCTCGGCGTCCGGCACAATCCCGGCGTGCCCCGGCGGGTACACGGTGACGGCCGGCGCGTCCGTCAGGCGATA
TCAAACGTGACGGCCAACGCGGTTGCGCACACGCAGACCGGGTCCGTCGACGTCGAGATGGCCGTCGTCGAGTTG
CGAGACGGACAGGCCATTGTCGAGATCACAGTGACGGACTCGGGCATCGGGATGAGCCCGCAGCAGCTCGACGCC
CTGTTCCGCGAGCTGGAGCAGGTCAGCAGCGAGGAGCCGGAGCCGGAGCCCAAGAGTCCCACGGACCAGGCCCAG
GGCGGGCGGACGCTGGGTCTCGGGCTGGCCCTGGTGGCGCGCATCGTCAGGAACATGGACGGGCAGCTGCGGCTC
AAGTCGGAGGAGGGCCAGGGCTCGAGGTTCGTGGTGCAGTTGCCCTTCCTACTGGCCGACGACTCTCCCGGCGAC
AACAGGGAGATGGAGGCGACGATGACGGCTTCGACGGCGGGTTCCATCAAGGCGGCGCCTCCTCCCGATGGCGAG
ATCTTGCTCATCGACGGAGGCCGCGTCTGCGTCGAAGGGAGCGCCGTGATGGCGCCCGACGATAACAGTGTCGGC
AGCCGGCACAGCCTCCGCAGCCGGGCCAGTCTCGGGAGCGACGCGGACCGGCTCATCAACGCCATCCAGACGCCG
CTGTCTCTCAACGACAACAACCAGACGGGTTACTTCGGCCACGTGCCCGATTCCAGCTGCAGTTCGGACCGGCGG
CCTTCGGGGACGTCGCTGACCGTGGCGGGTCCCTTGCCGACCAGCCCGACGCCGGGGAGGAAGCTGGCGCTGCTG
CCGAGACACGAGCCGGGGACGGAGGAGATTCGCGACTCCAAGACGCCGCTCCGGGCCGTCAAGGTGCCGGACGAG
TACAAGAAGATGCCGCGGATCGTACAGGAGCTGCCCGAGCCAGCCGAGAAGGACGGCAAGAAGGAGACGACGACG
GATGTCGGACTTCGCACTCTGGTGGCCGAGGACGATCCCATCAACATGAAGGTGCTGAGCAAGAGGCTGGAGAAG
GCCGGTCACGAGGTGCGGCATGCCGTCAACGGCGAGGACTGCGCGACGGTGTACAAGGGCGATTCGTCGTCGTTT
GACGTGATTCTCATGGACATGCAGATGCCCATCGTCGACGGCCTTACTAGCACCAAGATGATCCGTTCGATCGAA
AGCACGGCAGAGCACAAGGGCTACTCTCGGCTGGCCACTTCCAACGGCCGAGTCCCCATCTTCGCCGTCTCGGCC
TCGCTGGTAGAGCGAGAGAAGCAGGTCTACATCGACGCCGGCTTCGACGGCTGGATCCTCAAGCCCATCGACTTC
AAGAGGCTCAACACGCTGCTTCAGGGAATCCGCGACGGCCAGACGCGAAGCACGTGCCTCTACGTCGAGGGCGAG
TGGGAACGTGGCGGCTGGTTCGTCATGCCGCCCGATGCCTCTTCCTGTGTCACCGCCAGCGACGACACGACGCCC
CGGGCCGAGGAGACGACGTGTTAA
Transcript >Ophcf2|01137
ATGGACGACAGGCAGCAGCCAGACGTCGACGGTGATGATTTTGGCGCCACGCCGCGACGGGGCACTCGATCCAGT
CCCTTCAGCCCCGAGGCATCGTCGCCCTTCCCGTCCTTTGTCCAGTCGCCAGACGCTGCCCAGGGCGTCATCAGC
CCCGATCCCGTCTCGTCGTCGTGGAGCACAAGCTCTGAGAAGCACATGTGCACCCGCTCCGCCGCCTCGGACATC
TCGGTCGACCGCGTTTTCCCCATCAGGTCCGTCATCACCGTCGCTCCCACTCCGCGCCGCCCTTCAAACTCTGTC
GACGACTACTTTACCCTTCGATCCGACGAAACGGGTGCCCAGACTCGCAGCCGTTGGCGCGACCGTCGACCGGCT
GCCCTCTCGGCAGACCTGCGAAGGGTCGACTCTACCCCCTTGCCCGCTCACCCGCTGTCGGCCTCTGAGGCGAGC
CCTGGCGCCCAGCCCTCCTGGTCGCGCCGCAAGAGGCCTCTGAGTGGTCCCTTGTCCAGCATCCAGGCCGACGCC
GCTCGCAAGGGCACCATCGGTCCGCTGAACCTGGCCATGGCCTCCGCCTCGGACGACGGCTCCGACGACTCGGCC
GCCATAAGGCCGCCCCGATCCTCGGCCAGGATTCCCGGTCCCATCCGCGGGAGCGCGTCAGCCGCCTCGGGTCGG
CAGTCCTTGTCCGACATGCCGCACGTCACGACGCGCTTCACCCACGTGCAGACCGAGGGCGGTCACGCCGTCATC
ACCGGCCGCGACGGCGTCCTCCAGCGCTGCGAAGACGAGCCCATCCACACGCCTGGCGCCGTCCAGGGCTTTGGC
ATCCTCATCGCCCTCCGCGAGGAAAACGACGGCAGCTTCATTGTGCGATACGCGAGCGAAAATTCGGACAAGATG
CTCGGCTACAGCCCCAAGCAGCTCTTTCAGCTCACCAACTTCATGGATATCCTGACCGAGGAGCAGCAGGACAAC
CTGCTCGACCACATCGACTTCATCCGCGACGAGGACGCCGACCCGTCCGCTAACGGCCCCGAGGTCCTCAGCCTC
TCGGTCCGGCACCCCAAGAGGAGGCGGAGCGTCAAGCTCTGGTGCGCCATCCACATCAACCCTGCCCATCCCGAC
CTCATCATCTGCGAGTTCGAGCGCGACGACGACCAGGAGTTCCCGCTCCGTCCCACCGACGAGCTGACGCCCGAC
GCCCCCCACGACACGCTGCACTCCAACCCCAACCTCGAGGAGATTGAGGAGAGCACCGAGGTGCTGAGCAAGCCG
CTGCGCATCTTGCGGAGCGCACGCAAGCGAAGGGGCGAGCAGGGCGCCATGCAGGTCTTTGACATCATGTCTCAG
GTCCAGGAGCAGCTGGCCTCGGCTTCCAACCTCGACAACTTTCTCAAGATCCTCGTCGGCATCTTCAAGGAGCTG
ACGGGCTTCCACCGCGTCATGGTTTACCAGTTCGACTCCTCCTTCAACGGCAAGGTCGTCACCGAACTCGTCGAC
ACCTCGCAGACGCTCGACCTCTACAAGGGCCTCAACTTTCCGGCCTCGGACATCCCTCGGCAGGCCCGTGACCTG
TATAGGATCAACAAGGTCCGGCTCCTGTACGATCGCGATCTCGAGACGGCACGCATCGTCTGCCGCTCGGCCGAG
GACCTCGAGATGCCGCTCGACATGACGCACGCCTACCTCCGCGCCATGTCGCCCATCCACCTCAAGTATCTCGGC
AACATGGCCGTTCGTTCCTCCATGTCCATCTCCATCAACGCCTTTGACGAGCTGTGGGGGCTCATCGCCTGCCAC
TCGTACGGCCCCCACGGGATGCGCGTCTCGTTTCCGATACGCAAGATGTGCCGCCTGGTGGGAGACACGGCCTCG
CGAAACATCGAGAGGCTGTCGTACGCCTCGAGGCTGCAGGCGCGGAAGCTCATCAACACGGCGCCGACGGATAAC
AACCCGACCGGTTACATCATAGCCTCGTCCGACGATCTTCTCAAGCTCTTCGACGCCGACTTCGGCCTGCTGTCC
ATCCGGGGCGAGACCAAGGTGCTGGGCACGCTGGAGCACAGTCAGGAGGCGCTGGCCATGCTAGAGTATCTCCGG
ATGCGGAGGCTGACGGCCGTGCTGACGTCTCAGGACATTGCCGAGGACTTTCCCGACCTCCTGTACCCGCCGGGC
TTTCAGGTCATCGCCGGCCTGCTGTACGTGCCCCTGAGCGTCGGCGGCCATGACTTCATCGTCTTCTTCCGCAGG
GGCCAGGTGAGAGAGGTCAAGTGGGCTGGCAACCCGTACGAGAAGACCATCAGGCAGGGGACGTCGGGCTACCTC
GAGCCGCGCAGCAGCTTCAAGACGTGGCGGGAGACGGTCATTGGCAAGTGTCGGGAGTGGAACGAGGAGCAGGTC
GAGACGGCCGCGGTGCTGTGTCTGGTATACGGCAAATTCATCGAGGTCTGGAGACAAAAGGAGGCGGCGCTGCAG
AACAGCAAGCTGACGCGGCTGCTGCTGGCCAACTCGGCTCACGAAGTACGGACGCCGCTCAACGCCATCATCAAC
TACCTGGAGATTGCGCTCGAAGGCTCGCTGGACCAGGAGACTCGCGACAACCTGGCGCGGTCGCACTCGGCTTCC
AAGTCCCTCATCTACGTCATCAACGACCTCCTCGATCTGACCAAGACGGAGGAGGGTCAGAACCTGATCAAGGAC
GAGGTCTTCGACTTGGTGGCCTGCCTGGAAGAAGCGACGGAGCCCTTCCACATCGACGCCAAGCGCAAGGGCATC
GGCCTCGGCGTCCGGCACAATCCCGGCGTGCCCCGGCGGGTACACGGTGACGGCCGGCGCGTCCGTCAGGCGATA
TCAAACGTGACGGCCAACGCGGTTGCGCACACGCAGACCGGGTCCGTCGACGTCGAGATGGCCGTCGTCGAGTTG
CGAGACGGACAGGCCATTGTCGAGATCACAGTGACGGACTCGGGCATCGGGATGAGCCCGCAGCAGCTCGACGCC
CTGTTCCGCGAGCTGGAGCAGGTCAGCAGCGAGGAGCCGGAGCCGGAGCCCAAGAGTCCCACGGACCAGGCCCAG
GGCGGGCGGACGCTGGGTCTCGGGCTGGCCCTGGTGGCGCGCATCGTCAGGAACATGGACGGGCAGCTGCGGCTC
AAGTCGGAGGAGGGCCAGGGCTCGAGGTTCGTGGTGCAGTTGCCCTTCCTACTGGCCGACGACTCTCCCGGCGAC
AACAGGGAGATGGAGGCGACGATGACGGCTTCGACGGCGGGTTCCATCAAGGCGGCGCCTCCTCCCGATGGCGAG
ATCTTGCTCATCGACGGAGGCCGCGTCTGCGTCGAAGGGAGCGCCGTGATGGCGCCCGACGATAACAGTGTCGGC
AGCCGGCACAGCCTCCGCAGCCGGGCCAGTCTCGGGAGCGACGCGGACCGGCTCATCAACGCCATCCAGACGCCG
CTGTCTCTCAACGACAACAACCAGACGGGTTACTTCGGCCACGTGCCCGATTCCAGCTGCAGTTCGGACCGGCGG
CCTTCGGGGACGTCGCTGACCGTGGCGGGTCCCTTGCCGACCAGCCCGACGCCGGGGAGGAAGCTGGCGCTGCTG
CCGAGACACGAGCCGGGGACGGAGGAGATTCGCGACTCCAAGACGCCGCTCCGGGCCGTCAAGGTGCCGGACGAG
TACAAGAAGATGCCGCGGATCGTACAGGAGCTGCCCGAGCCAGCCGAGAAGGACGGCAAGAAGGAGACGACGACG
GATGTCGGACTTCGCACTCTGGTGGCCGAGGACGATCCCATCAACATGAAGGTGCTGAGCAAGAGGCTGGAGAAG
GCCGGTCACGAGGTGCGGCATGCCGTCAACGGCGAGGACTGCGCGACGGTGTACAAGGGCGATTCGTCGTCGTTT
GACGTGATTCTCATGGACATGCAGATGCCCATCGTCGACGGCCTTACTAGCACCAAGATGATCCGTTCGATCGAA
AGCACGGCAGAGCACAAGGGCTACTCTCGGCTGGCCACTTCCAACGGCCGAGTCCCCATCTTCGCCGTCTCGGCC
TCGCTGGTAGAGCGAGAGAAGCAGGTCTACATCGACGCCGGCTTCGACGGCTGGATCCTCAAGCCCATCGACTTC
AAGAGGCTCAACACGCTGCTTCAGGGAATCCGCGACGGCCAGACGCGAAGCACGTGCCTCTACGTCGAGGGCGAG
TGGGAACGTGGCGGCTGGTTCGTCATGCCGCCCGATGCCTCTTCCTGTGTCACCGCCAGCGACGACACGACGCCC
CGGGCCGAGGAGACGACGTGTTAA
Gene >Ophcf2|01137
ATGGACGACAGGCAGCAGCCAGACGTCGACGGTGATGATTTTGGCGCCACGCCGCGACGGGGCACTCGATCCAGT
CCCTTCAGCCCCGAGGCATCGTCGCCCTTCCCGTCCTTTGTCCAGTCGCCAGACGCTGCCCAGGGCGTCATCAGC
CCCGATCCCGTCTCGTCGTCGTGGAGCACAAGCTCTGAGAAGCACATGTGCACCCGCTCCGCCGCCTCGGACATC
TCGGTCGACCGCGTTTTCCCCATCAGGTCCGTCATCACCGTCGCTCCCACTCCGCGCCGCCCTTCAAACTCTGTC
GACGACTACTTTACCCTTCGATCCGACGAAACGGGTGCCCAGACTCGCAGCCGTTGGCGCGACCGTCGACCGGCT
GCCCTCTCGGCAGACCTGCGAAGGGTCGACTCTACCCCCTTGCCCGCTCACCCGCTGTCGGCCTCTGAGGCGAGC
CCTGGCGCCCAGCCCTCCTGGTCGCGCCGCAAGAGGCCTCTGAGTGGTCCCTTGTCCAGCATCCAGGCCGACGCC
GCTCGCAAGGGCACCATCGGTCCGCTGAACCTGGCCATGGCCTCCGCCTCGGACGACGGCTCCGACGACTCGGCC
GCCATAAGGCCGCCCCGATCCTCGGCCAGGATTCCCGGTCCCATCCGCGGGAGCGCGTCAGCCGCCTCGGGTCGG
CAGTCCTTGTCCGACATGCCGCACGTCACGACGCGCTTCACCCACGTGCAGACCGAGGGCGGTCACGCCGTCATC
ACCGGCCGCGACGGCGTCCTCCAGCGCTGCGAAGACGAGCCCATCCACACGCCTGGCGCCGTCCAGGGCTTTGGC
ATCCTCATCGCCCTCCGCGAGGAAAACGACGGCAGCTTCATTGTGCGATACGCGAGCGAAAATTCGGACAAGATG
CTCGGCTACAGCCCCAAGCAGCTCTTTCAGCTCACCAACTTCATGGATATCCTGACCGAGGAGCAGCAGGACAAC
CTGCTCGACCACATCGACTTCATCCGCGACGAGGACGCCGACCCGTCCGCTAACGGCCCCGAGGTCCTCAGCCTC
TCGGTCCGGCACCCCAAGAGGAGGCGGAGCGTCAAGCTCTGGTGCGCCATCCACATCAACCCTGCCCATCCCGAC
CTCATCATCTGCGAGTTCGAGCGCGACGACGACCAGGAGTTCCCGCTCCGTCCCACCGACGAGCTGACGCCCGAC
GCCCCCCACGACACGCTGCACTCCAACCCCAACCTCGAGGAGATTGAGGAGAGCACCGAGGTGCTGAGCAAGCCG
CTGCGCATCTTGCGGAGCGCACGCAAGCGAAGGGGCGAGCAGGGCGCCATGCAGGTCTTTGACATCATGTCTCAG
GTCCAGGAGCAGCTGGCCTCGGCTTCCAACCTCGACAACTTTCTCAAGATCCTCGTCGGCATCTTCAAGGAGCTG
ACGGGCTTCCACCGCGTCATGGTTTACCAGTTCGACTCCTCCTTCAACGGCAAGGTCGTCACCGAACTCGTCGAC
ACCTCGCAGACGCTCGACCTCTACAAGGGCCTCAACTTTCCGGCCTCGGACATCCCTCGGCAGGCCCGTGACCTG
TATAGGATCAACAAGGTCCGGCTCCTGTACGATCGCGATCTCGAGACGGCACGCATCGTCTGCCGCTCGGCCGAG
GACCTCGAGATGCCGCTCGACATGACGCACGCCTACCTCCGCGCCATGTCGCCCATCCACCTCAAGTATCTCGGC
AACATGGCCGTTCGTTCCTCCATGTCCATCTCCATCAACGCCTTTGACGAGCTGTGGGGGCTCATCGCCTGCCAC
TCGTACGGCCCCCACGGGATGCGCGTCTCGTTTCCGATACGCAAGATGTGCCGCCTGGTGGGAGACACGGCCTCG
CGAAACATCGAGAGGCTGTCGTACGCCTCGAGGCTGCAGGCGCGGAAGCTCATCAACACGGCGCCGACGGATAAC
AACCCGACCGGTTACATCATAGCCTCGTCCGACGATCTTCTCAAGCTCTTCGACGCCGACTTCGGCCTGCTGTCC
ATCCGGGGCGAGACCAAGGTGCTGGGCACGCTGGAGCACAGTCAGGAGGCGCTGGCCATGCTAGAGTATCTCCGG
ATGCGGAGGCTGACGGCCGTGCTGACGTCTCAGGACATTGCCGAGGACTTTCCCGACCTCCTGTACCCGCCGGGC
TTTCAGGTCATCGCCGGCCTGCTGTACGTGCCCCTGAGCGTCGGCGGCCATGACTTCATCGTCTTCTTCCGCAGG
GGCCAGGTGAGAGAGGTCAAGTGGGCTGGCAACCCGTACGAGAAGACCATCAGGCAGGGGACGTCGGGCTACCTC
GAGCCGCGCAGCAGCTTCAAGACGTGGCGGGAGACGGTCATTGGCAAGTGTCGGGAGTGGAACGAGGAGCAGGTC
GAGACGGCCGCGGTGCTGTGTCTGGTATACGGTCAGTACAGTTGAAGAGCAACCGACGATGAGATTGGAAGCTGA
CTCGTTTCTCGCAGGCAAATTCATCGAGGTCTGGAGACAAAAGGAGGCGGCGCTGCAGAACAGCAAGCTGACGCG
GCTGCTGCTGGCCAACTCGGCTCACGAAGTACGGACGCCGCTCAACGCCATCATCAACTACCTGGAGATTGCGCT
CGAAGGCTCGCTGGACCAGGAGACTCGCGACAACCTGGCGCGGTCGCACTCGGCTTCCAAGTCCCTCATCTACGT
CATCAACGACCTCCTCGATCTGACCAAGACGGAGGAGGGTCAGAACCTGATCAAGGACGAGGTCTTCGACTTGGT
GGCCTGCCTGGAAGAAGCGACGGAGCCCTTCCACATCGACGCCAAGCGCAAGGGCATCGGCCTCGGCGTCCGGCA
CAATCCCGGCGTGCCCCGGCGGGTACACGGTGACGGCCGGCGCGTCCGTCAGGCGATATCAAACGTGACGGCCAA
CGCGGTTGCGCACACGCAGACCGGGTCCGTCGACGTCGAGATGGCCGTCGTCGAGTTGCGAGACGGACAGGCCAT
TGTCGAGATCACAGTGACGGACTCGGGCATCGGGATGAGCCCGCAGCAGCTCGACGCCCTGTTCCGCGAGCTGGA
GCAGGTCAGCAGCGAGGAGCCGGAGCCGGAGCCCAAGAGTCCCACGGACCAGGCCCAGGGCGGGCGGACGCTGGG
TCTCGGGCTGGCCCTGGTGGCGCGCATCGTCAGGAACATGGACGGGCAGCTGCGGCTCAAGTCGGAGGAGGGCCA
GGGCTCGAGGTTCGTGGTGCAGTTGCCCTTCCTACTGGCCGACGACTCTCCCGGCGACAACAGGGAGATGGAGGC
GACGATGACGGCTTCGACGGCGGGTTCCATCAAGGCGGCGCCTCCTCCCGATGGCGAGATCTTGCTCATCGACGG
AGGCCGCGTCTGCGTCGAAGGGAGCGCCGTGATGGCGCCCGACGATAACAGTGTCGGCAGCCGGCACAGCCTCCG
CAGCCGGGCCAGTCTCGGGAGCGACGCGGACCGGCTCATCAACGCCATCCAGACGCCGCTGTCTCTCAACGACAA
CAACCAGACGGGTTACTTCGGCCACGTGCCCGATTCCAGCTGCAGTTCGGACCGGCGGCCTTCGGGGACGTCGCT
GACCGTGGCGGGTCCCTTGCCGACCAGCCCGACGCCGGGGAGGAAGCTGGCGCTGCTGCCGAGACACGAGCCGGG
GACGGAGGAGATTCGCGACTCCAAGACGCCGCTCCGGGCCGTCAAGGTGCCGGACGAGTACAAGAAGATGCCGCG
GATCGTACAGGAGCTGCCCGAGCCAGCCGAGAAGGACGGCAAGAAGGAGACGACGACGGATGTCGGACTTCGCAC
TCTGGTGGCCGAGGACGATCCCATCAACATGAAGGTGCTGAGCAAGAGGCTGGAGAAGGCCGGTCACGAGGTGCG
GCATGCCGTCAACGGCGAGGACTGCGCGACGGTGTACAAGGGCGATTCGTCGTCGTTTGACGTGATTCTCATGGA
CATGCAGGTGAGTTGTTGCGTGACATGAAGACGGATGTGGAATTCCCACGCTGACTCGGTCCATCTTTAGATGCC
CATCGTCGACGGCCTTACTAGCACCAAGATGATCCGTTCGATCGAAAGCACGGCAGAGCACAAGGGCTACTCTCG
GCTGGCCACTTCCAACGGCCGAGTCCCCATCTTCGCCGTCTCGGCCTCGCTGGTAGAGCGAGAGAAGCAGGTCTA
CATCGACGCCGGCTTCGACGGCTGGATCCTCAAGCCCATCGACTTCAAGAGGCTCAACACGCTGCTTCAGGGAAT
CCGCGACGGCCAGACGCGAAGCACGTGCCTCTACGTCGAGGGCGAGTGGGAACGTGGCGGCTGGTTCGTCATGCC
GCCCGATGCCTCTTCCTGTGTCACCGCCAGCGACGACACGACGCCCCGGGCCGAGGAGACGACGTGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail