Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01136
Gene name
Locationscaffold_01:4142973..4147927
Strand+
Gene length (bp)4954
Transcript length (bp)4869
Coding sequence length (bp)4869
Protein length (aa) 1623

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 2.1E-18 508 637
PF00005 ABC_tran ABC transporter 3.7E-26 1272 1424
PF12698 ABC2_membrane_3 ABC-2 family transporter protein 2.9E-13 951 1213

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 240 262 22
3 291 313 22
4 323 345 22
5 379 401 22
6 421 443 22
7 823 845 22
8 1003 1025 22
9 1045 1067 22
10 1082 1104 22
11 1111 1133 22
12 1148 1170 22
13 1191 1213 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01136
MIAKQPARCLLLRQIWTLMQKDLRCLIRRHGILTVCVAFIMPILLAGFFTFAKNLFLPPAQFGIGTARPIMTLRE
AAETARKSGHDRLILVDGPTNQGDQYNMSRVLDVIEDETRSYGSLLQTIRISQETELTSHCRSSLRGVTRCLGAV
VMRGAPSFGHWNYTIRTDAFVASGPQTVQVGRNKNLEQVFVLPLQRAVDSAIAIIEGHGPLTTANEWPFTSKTQA
EHGEIARMRYLNNIVSFMGVAFVTTIVGVTYHLAGAVATDRESGMARLMDAMMPGGRPGAAQATRIVAHHLAYTM
LYAPAWIVAAFIIRYGIFIHTSIVIIVVLQLLGGLALVSMAILSASFFNRAQLSSSCATLATLILAILAQSLTSP
RTTTVSVLSALFAPCNYVYFVTLVARFERTNRPTSLMDEAPGNSPWSVPGLALWLLLGMQIICYPLLAAWVERWR
FGTPADGRRYGRPKPEADEDETAVRLDGLTKVYYPALLPRLASYLRCGRASEPVVAVNGLSLSCRRGQIVTLLGA
NGSGKSTTLDAIAGLHQPTGGSIVVDGGLGIAPQKNVLWDDVTVLDHLETFGRLKSPAQPPTAEETADLVRAIDL
WPKRDALAKTLSGGQKRKLQLGMMLAGGSSVCCVDEVSSGLDPISRRKIWDILLAERGRRTLILTTHFLDEADLL
ADHMAVLSRGALRAAGSSVELKERFGGGYHVRVPAGSGSGPEVDGVGRKEAPDGTTYAAPTSDLAARVIRKLDAA
GIGDYHFSSPTIEDVFLRLAEEVAMDETKTTTTTTTEKALAASPLQLMDGTPIGNGRQMTVLLRKRATVFKRNWL
LYLVAFLLPIAAAAMTSMYARGRGAPVCGPPDGRTVQDALGQMRSTDYSPVLAIGPASRLNDSDLAQVLMPLLTE
ARQRHGSEAGETDVSRNQLLWADTYDDFGSLVEGRWRNLTAGVWLGAAADDETRPTVAWLANKAVTVPLMAQQLL
DSLQNRPPTTVLASWLPFDVPFDPGVGSVLNLVVYMGLALVFFPAFFGLYPSGERVGGVRALQYSNGVRPLPLWA
AYVAFDMSVVLPAAALATALWAALAAGSWYHVGYVFVVLALYGLASTELAYLVSLWAPSQLASFAWTASLQAVLF
LVYLVAYVCVLTYVSVDRVDGTLLVAHFVLAAVAPICSVVRSLFVVTNLFSTACDGRQPSTNPGGLLLYGGPMLY
LAIQSIVFFGLLLWFDSSGPGLLSSCHPRRARRGSTASDVDHDEAVAAVASPPAGLSVRNLSKSFGRNTAVDDVS
FDVKRGEVFALLGPNGAGKSTTMALIRGDERPSRGRGGGGGGGGGGGDVMIGPLSVTRRRAAARARLGVCPQADA
LDSSMTVREHLDFYARVRGVPDARHNVEEVIRAVGLQSLSRRMATALSGGNKRKLSLAIALMGNPAVILLDEPSS
GLDAAAKRVLWPVLASTAVGRSILLTTHSMEEADALAARAGILARRMLAVGSLDELRRRAGHRLHVHLVASSAPR
TTREEMAAMTEWVRIAMPDAEMEAATYHGQLRFAVRAQDVSSASENLARHHQLQSRPQKQQPSVTTAEPDESSKP
LTPREEKHVVPDSDLDSDSSDAATTTTTTTTTTDFLLPQCQPGDRAL*
Coding >Ophcf2|01136
ATGATCGCCAAGCAGCCGGCCAGGTGCCTCCTGCTCCGCCAGATATGGACGCTCATGCAAAAGGATCTCCGATGC
CTGATCCGGCGGCACGGGATCCTCACGGTCTGCGTGGCCTTTATCATGCCGATCCTCTTGGCAGGTTTCTTCACC
TTTGCCAAGAACCTATTCCTACCGCCTGCCCAGTTCGGCATCGGCACCGCTCGACCCATCATGACGCTGCGGGAA
GCGGCCGAGACGGCGCGCAAGAGCGGCCACGACCGGCTGATACTGGTCGACGGCCCGACCAACCAGGGAGACCAA
TACAACATGTCACGCGTGCTGGACGTCATCGAGGACGAGACGCGGTCTTACGGGTCGCTGCTGCAGACGATTCGA
ATCTCCCAGGAGACGGAGCTCACATCGCACTGCCGCAGCTCACTGAGAGGCGTGACGCGGTGCTTGGGGGCCGTC
GTCATGCGTGGAGCGCCGTCATTCGGGCATTGGAACTATACCATTCGGACCGACGCCTTCGTAGCCTCGGGCCCG
CAGACGGTTCAGGTGGGCCGCAACAAGAACCTAGAGCAGGTGTTTGTGCTGCCGCTGCAACGGGCCGTTGACTCT
GCCATTGCCATCATCGAAGGCCACGGGCCCCTGACGACGGCTAACGAGTGGCCCTTTACCAGCAAGACGCAGGCC
GAGCACGGCGAAATCGCCCGGATGAGATATCTCAACAACATCGTCAGCTTCATGGGTGTCGCCTTCGTCACTACC
ATCGTCGGCGTCACCTATCACCTGGCCGGCGCTGTGGCCACCGATCGCGAGTCCGGAATGGCTCGCCTGATGGAC
GCCATGATGCCGGGGGGCCGGCCTGGTGCGGCTCAGGCGACACGCATCGTGGCCCATCACCTCGCCTACACGATG
CTATACGCGCCGGCATGGATCGTCGCTGCCTTCATCATCCGTTACGGCATCTTCATCCACACCTCCATCGTCATC
ATCGTCGTGCTACAGCTTCTCGGCGGACTGGCACTCGTCTCGATGGCCATCTTGAGCGCCAGCTTCTTCAATCGG
GCTCAGCTCAGCAGCTCGTGCGCGACGCTGGCGACGCTGATACTGGCCATCCTGGCCCAGTCGCTGACATCGCCG
AGGACGACGACGGTATCCGTGCTGTCGGCCCTGTTCGCGCCCTGCAACTACGTCTACTTCGTGACGCTCGTGGCC
CGCTTCGAGCGGACCAACCGGCCGACGAGCCTCATGGACGAGGCCCCCGGCAACAGCCCCTGGTCGGTACCGGGT
CTGGCCCTGTGGCTACTCCTCGGGATGCAGATCATCTGCTATCCGCTGCTGGCGGCCTGGGTCGAGCGATGGCGC
TTCGGCACGCCGGCCGACGGGCGACGCTACGGCCGGCCGAAGCCGGAGGCGGACGAGGACGAGACGGCGGTGCGG
CTCGACGGGCTGACCAAGGTCTACTACCCGGCCTTGCTACCGCGGCTGGCCTCGTACCTCCGATGCGGCCGGGCG
TCAGAGCCGGTGGTGGCGGTCAACGGGCTGAGCCTCAGCTGTCGGCGCGGCCAGATCGTGACGCTGCTCGGGGCC
AACGGCAGCGGCAAGAGCACGACTCTCGACGCCATCGCCGGCCTTCACCAGCCTACGGGCGGCTCCATCGTCGTC
GACGGAGGGCTCGGCATCGCGCCGCAGAAGAACGTGCTATGGGACGACGTGACGGTACTGGACCACCTGGAGACG
TTTGGTCGGCTCAAGTCGCCGGCCCAGCCGCCGACGGCCGAAGAGACGGCCGACCTCGTCAGGGCCATCGACCTG
TGGCCCAAGCGGGACGCGCTGGCCAAGACGCTCTCGGGCGGACAGAAGCGCAAGCTCCAGCTGGGCATGATGCTG
GCCGGCGGCAGCTCCGTCTGCTGCGTCGACGAGGTCAGCAGCGGACTGGATCCCATCTCGAGGCGCAAGATATGG
GACATCCTGCTGGCGGAGCGAGGCCGGAGGACGCTGATCCTGACGACGCACTTTCTCGACGAGGCCGACCTGCTG
GCCGATCACATGGCCGTCTTGTCCCGAGGCGCGCTCCGGGCCGCCGGCTCTTCGGTAGAGCTCAAGGAGCGCTTC
GGCGGCGGTTATCACGTGCGCGTCCCGGCCGGGTCCGGGTCCGGGCCCGAGGTGGACGGGGTGGGGCGAAAGGAG
GCTCCGGACGGGACGACGTACGCGGCGCCGACTTCGGATCTGGCGGCTCGCGTCATCCGGAAGCTCGACGCCGCG
GGAATCGGCGATTATCATTTCTCTAGCCCGACTATCGAGGACGTCTTCTTGCGGCTGGCCGAGGAGGTGGCCATG
GATGAGACGAAGACGACGACTACCACCACCACCGAAAAGGCTCTTGCAGCCTCGCCGCTCCAACTCATGGACGGC
ACCCCGATCGGTAACGGACGGCAGATGACGGTGCTGCTCCGGAAGAGGGCCACCGTCTTCAAACGTAACTGGCTG
CTGTACCTGGTGGCCTTCTTGCTGCCCATCGCGGCGGCGGCCATGACATCGATGTACGCGCGGGGCAGGGGAGCG
CCAGTCTGCGGGCCTCCGGATGGTAGGACGGTTCAGGACGCTCTGGGTCAGATGAGAAGCACGGATTACAGTCCG
GTGCTGGCCATCGGTCCGGCGTCACGGCTGAACGACTCGGACCTGGCCCAGGTCCTGATGCCGCTGCTGACCGAG
GCGCGGCAGAGGCACGGGTCCGAGGCCGGGGAGACGGACGTGAGCCGGAATCAGCTCCTGTGGGCAGACACGTAC
GACGACTTCGGCAGTCTGGTCGAGGGAAGATGGCGGAACCTGACGGCCGGCGTCTGGCTCGGAGCCGCGGCCGAC
GACGAGACTCGACCGACGGTGGCCTGGCTGGCTAACAAGGCGGTCACGGTACCCTTGATGGCGCAGCAGCTGCTC
GACTCGCTGCAGAACAGGCCGCCGACGACGGTGCTGGCGTCTTGGCTGCCCTTTGACGTGCCCTTCGACCCGGGC
GTGGGATCGGTGCTCAACCTGGTCGTCTACATGGGACTGGCCCTGGTCTTCTTCCCTGCCTTCTTCGGCCTCTAT
CCCAGCGGAGAGCGCGTCGGCGGCGTCCGGGCCCTCCAATACTCCAACGGAGTCCGGCCTCTACCGCTATGGGCC
GCCTACGTCGCCTTCGACATGTCCGTCGTCCTCCCGGCCGCGGCGCTGGCCACGGCTCTCTGGGCGGCGCTGGCG
GCCGGATCTTGGTATCACGTCGGCTACGTCTTCGTCGTCCTGGCTCTGTACGGCCTGGCCTCGACAGAATTGGCC
TACCTGGTCTCCCTCTGGGCGCCGTCGCAGCTGGCGAGCTTTGCCTGGACGGCGTCGCTGCAGGCCGTCTTGTTC
CTCGTCTATCTCGTCGCCTACGTCTGTGTGCTGACGTACGTGAGCGTCGATCGCGTCGACGGCACGCTCCTCGTC
GCTCATTTCGTGCTGGCCGCCGTTGCGCCCATCTGCTCCGTCGTCCGCTCGCTCTTCGTCGTCACCAATCTCTTC
TCGACCGCCTGTGACGGCCGTCAGCCTTCGACGAATCCGGGAGGCCTGCTGCTGTACGGCGGACCGATGCTGTAC
CTGGCCATCCAGAGCATCGTCTTCTTCGGCCTGCTCCTCTGGTTCGACTCTTCCGGTCCGGGCCTCCTCTCATCA
TGTCATCCGAGGAGGGCCCGTCGCGGATCGACGGCCAGTGACGTCGATCATGATGAAGCCGTCGCCGCCGTCGCC
TCTCCTCCCGCGGGCCTCAGCGTCAGGAACCTCAGCAAGTCGTTCGGCCGTAACACAGCCGTCGACGACGTCTCC
TTCGACGTGAAACGCGGCGAAGTCTTTGCGCTGCTCGGTCCCAACGGCGCCGGAAAGTCGACGACCATGGCCCTG
ATCCGCGGAGACGAACGGCCCAGTCGCGGCCGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGCGACGTCATG
ATCGGTCCCTTGTCGGTGACGCGTCGTCGAGCTGCGGCCAGGGCTCGCCTCGGAGTCTGTCCGCAGGCCGACGCT
CTGGATTCGTCCATGACGGTCCGTGAGCATCTCGACTTCTACGCCCGCGTCCGTGGCGTTCCGGACGCCCGTCAC
AACGTCGAGGAAGTCATCCGCGCCGTAGGACTGCAGTCCCTGTCTCGGCGGATGGCGACGGCGCTATCGGGAGGG
AACAAGCGGAAACTCAGCCTGGCCATCGCTCTCATGGGCAACCCTGCCGTCATCTTGCTCGACGAGCCTTCTTCG
GGCCTCGACGCAGCCGCCAAACGCGTCCTCTGGCCCGTCCTCGCCTCGACGGCAGTCGGACGGTCCATCCTCCTG
ACGACTCACAGCATGGAAGAGGCCGACGCCTTGGCTGCCCGGGCCGGAATCCTAGCCCGTCGAATGCTGGCCGTA
GGTTCCCTCGACGAGCTCCGTCGGAGAGCCGGTCATCGGCTTCACGTCCACCTCGTGGCCTCGTCAGCTCCGCGA
ACCACACGGGAAGAGATGGCCGCCATGACGGAATGGGTCCGCATCGCCATGCCCGACGCCGAGATGGAAGCTGCA
ACGTATCACGGCCAACTCCGCTTCGCCGTCCGAGCCCAAGACGTATCCTCGGCCTCTGAGAACCTCGCCCGTCAT
CACCAACTTCAGTCTCGGCCGCAAAAGCAACAGCCAAGCGTCACCACCGCCGAGCCCGATGAATCCTCCAAACCG
CTCACCCCGCGCGAAGAGAAACACGTCGTGCCGGACTCGGACCTCGACTCTGACTCTTCCGACGCGGCGACGACG
ACCACCACCACCACCACCACCACTGACTTCCTCCTCCCCCAATGCCAGCCTGGGGATCGAGCACTATAG
Transcript >Ophcf2|01136
ATGATCGCCAAGCAGCCGGCCAGGTGCCTCCTGCTCCGCCAGATATGGACGCTCATGCAAAAGGATCTCCGATGC
CTGATCCGGCGGCACGGGATCCTCACGGTCTGCGTGGCCTTTATCATGCCGATCCTCTTGGCAGGTTTCTTCACC
TTTGCCAAGAACCTATTCCTACCGCCTGCCCAGTTCGGCATCGGCACCGCTCGACCCATCATGACGCTGCGGGAA
GCGGCCGAGACGGCGCGCAAGAGCGGCCACGACCGGCTGATACTGGTCGACGGCCCGACCAACCAGGGAGACCAA
TACAACATGTCACGCGTGCTGGACGTCATCGAGGACGAGACGCGGTCTTACGGGTCGCTGCTGCAGACGATTCGA
ATCTCCCAGGAGACGGAGCTCACATCGCACTGCCGCAGCTCACTGAGAGGCGTGACGCGGTGCTTGGGGGCCGTC
GTCATGCGTGGAGCGCCGTCATTCGGGCATTGGAACTATACCATTCGGACCGACGCCTTCGTAGCCTCGGGCCCG
CAGACGGTTCAGGTGGGCCGCAACAAGAACCTAGAGCAGGTGTTTGTGCTGCCGCTGCAACGGGCCGTTGACTCT
GCCATTGCCATCATCGAAGGCCACGGGCCCCTGACGACGGCTAACGAGTGGCCCTTTACCAGCAAGACGCAGGCC
GAGCACGGCGAAATCGCCCGGATGAGATATCTCAACAACATCGTCAGCTTCATGGGTGTCGCCTTCGTCACTACC
ATCGTCGGCGTCACCTATCACCTGGCCGGCGCTGTGGCCACCGATCGCGAGTCCGGAATGGCTCGCCTGATGGAC
GCCATGATGCCGGGGGGCCGGCCTGGTGCGGCTCAGGCGACACGCATCGTGGCCCATCACCTCGCCTACACGATG
CTATACGCGCCGGCATGGATCGTCGCTGCCTTCATCATCCGTTACGGCATCTTCATCCACACCTCCATCGTCATC
ATCGTCGTGCTACAGCTTCTCGGCGGACTGGCACTCGTCTCGATGGCCATCTTGAGCGCCAGCTTCTTCAATCGG
GCTCAGCTCAGCAGCTCGTGCGCGACGCTGGCGACGCTGATACTGGCCATCCTGGCCCAGTCGCTGACATCGCCG
AGGACGACGACGGTATCCGTGCTGTCGGCCCTGTTCGCGCCCTGCAACTACGTCTACTTCGTGACGCTCGTGGCC
CGCTTCGAGCGGACCAACCGGCCGACGAGCCTCATGGACGAGGCCCCCGGCAACAGCCCCTGGTCGGTACCGGGT
CTGGCCCTGTGGCTACTCCTCGGGATGCAGATCATCTGCTATCCGCTGCTGGCGGCCTGGGTCGAGCGATGGCGC
TTCGGCACGCCGGCCGACGGGCGACGCTACGGCCGGCCGAAGCCGGAGGCGGACGAGGACGAGACGGCGGTGCGG
CTCGACGGGCTGACCAAGGTCTACTACCCGGCCTTGCTACCGCGGCTGGCCTCGTACCTCCGATGCGGCCGGGCG
TCAGAGCCGGTGGTGGCGGTCAACGGGCTGAGCCTCAGCTGTCGGCGCGGCCAGATCGTGACGCTGCTCGGGGCC
AACGGCAGCGGCAAGAGCACGACTCTCGACGCCATCGCCGGCCTTCACCAGCCTACGGGCGGCTCCATCGTCGTC
GACGGAGGGCTCGGCATCGCGCCGCAGAAGAACGTGCTATGGGACGACGTGACGGTACTGGACCACCTGGAGACG
TTTGGTCGGCTCAAGTCGCCGGCCCAGCCGCCGACGGCCGAAGAGACGGCCGACCTCGTCAGGGCCATCGACCTG
TGGCCCAAGCGGGACGCGCTGGCCAAGACGCTCTCGGGCGGACAGAAGCGCAAGCTCCAGCTGGGCATGATGCTG
GCCGGCGGCAGCTCCGTCTGCTGCGTCGACGAGGTCAGCAGCGGACTGGATCCCATCTCGAGGCGCAAGATATGG
GACATCCTGCTGGCGGAGCGAGGCCGGAGGACGCTGATCCTGACGACGCACTTTCTCGACGAGGCCGACCTGCTG
GCCGATCACATGGCCGTCTTGTCCCGAGGCGCGCTCCGGGCCGCCGGCTCTTCGGTAGAGCTCAAGGAGCGCTTC
GGCGGCGGTTATCACGTGCGCGTCCCGGCCGGGTCCGGGTCCGGGCCCGAGGTGGACGGGGTGGGGCGAAAGGAG
GCTCCGGACGGGACGACGTACGCGGCGCCGACTTCGGATCTGGCGGCTCGCGTCATCCGGAAGCTCGACGCCGCG
GGAATCGGCGATTATCATTTCTCTAGCCCGACTATCGAGGACGTCTTCTTGCGGCTGGCCGAGGAGGTGGCCATG
GATGAGACGAAGACGACGACTACCACCACCACCGAAAAGGCTCTTGCAGCCTCGCCGCTCCAACTCATGGACGGC
ACCCCGATCGGTAACGGACGGCAGATGACGGTGCTGCTCCGGAAGAGGGCCACCGTCTTCAAACGTAACTGGCTG
CTGTACCTGGTGGCCTTCTTGCTGCCCATCGCGGCGGCGGCCATGACATCGATGTACGCGCGGGGCAGGGGAGCG
CCAGTCTGCGGGCCTCCGGATGGTAGGACGGTTCAGGACGCTCTGGGTCAGATGAGAAGCACGGATTACAGTCCG
GTGCTGGCCATCGGTCCGGCGTCACGGCTGAACGACTCGGACCTGGCCCAGGTCCTGATGCCGCTGCTGACCGAG
GCGCGGCAGAGGCACGGGTCCGAGGCCGGGGAGACGGACGTGAGCCGGAATCAGCTCCTGTGGGCAGACACGTAC
GACGACTTCGGCAGTCTGGTCGAGGGAAGATGGCGGAACCTGACGGCCGGCGTCTGGCTCGGAGCCGCGGCCGAC
GACGAGACTCGACCGACGGTGGCCTGGCTGGCTAACAAGGCGGTCACGGTACCCTTGATGGCGCAGCAGCTGCTC
GACTCGCTGCAGAACAGGCCGCCGACGACGGTGCTGGCGTCTTGGCTGCCCTTTGACGTGCCCTTCGACCCGGGC
GTGGGATCGGTGCTCAACCTGGTCGTCTACATGGGACTGGCCCTGGTCTTCTTCCCTGCCTTCTTCGGCCTCTAT
CCCAGCGGAGAGCGCGTCGGCGGCGTCCGGGCCCTCCAATACTCCAACGGAGTCCGGCCTCTACCGCTATGGGCC
GCCTACGTCGCCTTCGACATGTCCGTCGTCCTCCCGGCCGCGGCGCTGGCCACGGCTCTCTGGGCGGCGCTGGCG
GCCGGATCTTGGTATCACGTCGGCTACGTCTTCGTCGTCCTGGCTCTGTACGGCCTGGCCTCGACAGAATTGGCC
TACCTGGTCTCCCTCTGGGCGCCGTCGCAGCTGGCGAGCTTTGCCTGGACGGCGTCGCTGCAGGCCGTCTTGTTC
CTCGTCTATCTCGTCGCCTACGTCTGTGTGCTGACGTACGTGAGCGTCGATCGCGTCGACGGCACGCTCCTCGTC
GCTCATTTCGTGCTGGCCGCCGTTGCGCCCATCTGCTCCGTCGTCCGCTCGCTCTTCGTCGTCACCAATCTCTTC
TCGACCGCCTGTGACGGCCGTCAGCCTTCGACGAATCCGGGAGGCCTGCTGCTGTACGGCGGACCGATGCTGTAC
CTGGCCATCCAGAGCATCGTCTTCTTCGGCCTGCTCCTCTGGTTCGACTCTTCCGGTCCGGGCCTCCTCTCATCA
TGTCATCCGAGGAGGGCCCGTCGCGGATCGACGGCCAGTGACGTCGATCATGATGAAGCCGTCGCCGCCGTCGCC
TCTCCTCCCGCGGGCCTCAGCGTCAGGAACCTCAGCAAGTCGTTCGGCCGTAACACAGCCGTCGACGACGTCTCC
TTCGACGTGAAACGCGGCGAAGTCTTTGCGCTGCTCGGTCCCAACGGCGCCGGAAAGTCGACGACCATGGCCCTG
ATCCGCGGAGACGAACGGCCCAGTCGCGGCCGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGCGACGTCATG
ATCGGTCCCTTGTCGGTGACGCGTCGTCGAGCTGCGGCCAGGGCTCGCCTCGGAGTCTGTCCGCAGGCCGACGCT
CTGGATTCGTCCATGACGGTCCGTGAGCATCTCGACTTCTACGCCCGCGTCCGTGGCGTTCCGGACGCCCGTCAC
AACGTCGAGGAAGTCATCCGCGCCGTAGGACTGCAGTCCCTGTCTCGGCGGATGGCGACGGCGCTATCGGGAGGG
AACAAGCGGAAACTCAGCCTGGCCATCGCTCTCATGGGCAACCCTGCCGTCATCTTGCTCGACGAGCCTTCTTCG
GGCCTCGACGCAGCCGCCAAACGCGTCCTCTGGCCCGTCCTCGCCTCGACGGCAGTCGGACGGTCCATCCTCCTG
ACGACTCACAGCATGGAAGAGGCCGACGCCTTGGCTGCCCGGGCCGGAATCCTAGCCCGTCGAATGCTGGCCGTA
GGTTCCCTCGACGAGCTCCGTCGGAGAGCCGGTCATCGGCTTCACGTCCACCTCGTGGCCTCGTCAGCTCCGCGA
ACCACACGGGAAGAGATGGCCGCCATGACGGAATGGGTCCGCATCGCCATGCCCGACGCCGAGATGGAAGCTGCA
ACGTATCACGGCCAACTCCGCTTCGCCGTCCGAGCCCAAGACGTATCCTCGGCCTCTGAGAACCTCGCCCGTCAT
CACCAACTTCAGTCTCGGCCGCAAAAGCAACAGCCAAGCGTCACCACCGCCGAGCCCGATGAATCCTCCAAACCG
CTCACCCCGCGCGAAGAGAAACACGTCGTGCCGGACTCGGACCTCGACTCTGACTCTTCCGACGCGGCGACGACG
ACCACCACCACCACCACCACCACTGACTTCCTCCTCCCCCAATGCCAGCCTGGGGATCGAGCACTATAG
Gene >Ophcf2|01136
ATGATCGCCAAGCAGCCGGCCAGGTGCCTCCTGCTCCGCCAGATATGGACGCTCATGCAAAAGGATCTCCGATGC
CTGATCCGGCGGCACGGGATCCTCACGGTCTGCGTGGCCTTTATCATGCCGATCCTCTTGGCAGGTTTCTTCACC
TTTGCCAAGAACCTATTCCTACCGCCTGCCCAGTTCGGCATCGGCACCGCTCGACCCATCATGACGCTGCGGGAA
GCGGCCGAGACGGCGCGCAAGAGCGGCCACGACCGGCTGATACTGGTCGACGGCCCGACCAACCAGGGAGACCAA
TACAACATGTCACGCGTGCTGGACGTCATCGAGGACGAGACGCGGTCTTACGGGTCGCTGCTGCAGACGATTCGA
ATCTCCCAGGAGACGGAGCTCACATCGCACTGCCGCAGCTCACTGAGAGGCGTGACGCGGTGCTTGGGGGCCGTC
GTCATGCGTGGAGCGCCGTCATTCGGGCATTGGAACTATACCATTCGGACCGACGCCTTCGTAGCCTCGGGCCCG
CAGACGGTTCAGGTGGGCCGCAACAAGAACCTAGAGCAGGTGTTTGTGCTGCCGCTGCAACGGGCCGTTGACTCT
GCCATTGCCATCATCGAAGGCCACGGGCCCCTGACGACGGCTAACGAGTGGCCCTTTACCAGCAAGACGCAGGCC
GAGCACGGCGAAATCGCCCGGATGAGATATCTCAACAACATCGTCAGCTTCATGGGTGTCGCCTTCGTCACTACC
ATCGTCGGCGTCACCTATCACCTGGCCGGCGCTGTGGCCACCGATCGCGAGTCCGGAATGGCTCGCCTGATGGAC
GCCATGATGCCGGGGGGCCGGCCTGGTGCGGCTCAGGCGACACGCATCGTGGCCCATCACCTCGCCTACACGATG
CTATACGCGCCGGCATGGATCGTCGCTGCCTTCATCATCCGTTACGGCATCTTCATCCACACCTCCATCGTCATC
ATCGTCGTGCTACAGCTTCTCGGCGGACTGGCACTCGTCTCGATGGCCATCTTGAGCGCCAGCTTCTTCAATCGG
GCTCAGCTCAGCAGCTCGTGCGCGACGCTGGCGACGCTGATACTGGCCATCCTGGCCCAGTCGCTGACATCGCCG
AGGACGACGACGGTATCCGTGCTGTCGGCCCTGTTCGCGCCCTGCAACTACGTCTACTTCGTGACGCTCGTGGCC
CGCTTCGAGCGGACCAACCGGCCGACGAGCCTCATGGACGAGGCCCCCGGCAACAGCCCCTGGTCGGTACCGGGT
CTGGCCCTGTGGCTACTCCTCGGGATGCAGATCATCTGCTATCCGCTGCTGGCGGCCTGGGTCGAGCGATGGCGC
TTCGGCACGCCGGCCGACGGGCGACGCTACGGCCGGCCGAAGCCGGAGGCGGACGAGGACGAGACGGCGGTGCGG
CTCGACGGGCTGACCAAGGTCTACTACCCGGCCTTGCTACCGCGGCTGGCCTCGTACCTCCGATGCGGCCGGGCG
TCAGAGCCGGTGGTGGCGGTCAACGGGCTGAGCCTCAGCTGTCGGCGCGGCCAGATCGTGACGCTGCTCGGGGCC
AACGGCAGCGGCAAGAGCACGACTCTCGACGCCATCGCCGGCCTTCACCAGCCTACGGGCGGCTCCATCGTCGTC
GACGGAGGGCTCGGCATCGCGCCGCAGAAGAACGTGCTATGGGACGACGTGACGGTACTGGACCACCTGGAGACG
TTTGGTCGGCTCAAGTCGCCGGCCCAGCCGCCGACGGCCGAAGAGACGGCCGACCTCGTCAGGGCCATCGACCTG
TGGCCCAAGCGGGACGCGCTGGCCAAGACGCTCTCGGGCGGACAGAAGCGCAAGCTCCAGCTGGGCATGATGCTG
GCCGGCGGCAGCTCCGTCTGCTGCGTCGACGAGGTCAGCAGCGGACTGGATCCCATCTCGAGGCGCAAGATATGG
GACATCCTGCTGGCGGAGCGAGGCCGGAGGACGCTGATCCTGACGACGCACTTTCTCGACGAGGCCGACCTGCTG
GCCGATCACATGGCCGTCTTGTCCCGAGGCGCGCTCCGGGCCGCCGGCTCTTCGGTAGAGCTCAAGGAGCGCTTC
GGCGGCGGTTATCACGTGCGCGTCCCGGCCGGGTCCGGGTCCGGGCCCGAGGTGGACGGGGTGGGGCGAAAGGAG
GCTCCGGACGGGACGACGTACGCGGCGCCGACTTCGGATCTGGCGGCTCGCGTCATCCGGAAGCTCGACGCCGCG
GGAATCGGCGATTATCATTTCTCTAGCCCGACTATCGAGGACGTCTTCTTGCGGCTGGCCGAGGAGGTGGCCATG
GATGAGACGAAGACGACGACTACCACCACCACCGAAAAGGCTCTTGCAGCCTCGCCGCTCCAACTCATGGACGGC
ACCCCGATCGGTAACGGACGGCAGATGACGGTGCTGCTCCGGAAGAGGGCCACCGTCTTCAAACGTAACTGGCTG
CTGTACCTGGTGGCCTTCTTGCTGCCCATCGCGGCGGCGGCCATGACATCGATGTACGCGCGGGGCAGGGGAGCG
CCAGTCTGCGGGCCTCCGGATGGTAGGACGGTTCAGGACGCTCTGGGTCAGATGAGAAGCACGGATTACAGTCCG
GTGCTGGCCATCGGTCCGGCGTCACGGCTGAACGACTCGGACCTGGCCCAGGTCCTGATGCCGCTGCTGACCGAG
GCGCGGCAGAGGCACGGGTCCGAGGCCGGGGAGACGGACGTGAGCCGGAATCAGCTCCTGTGGGCAGACACGTAC
GACGACTTCGGCAGTCTGGTCGAGGGAAGATGGCGGAACCTGACGGCCGGCGTCTGGCTCGGAGCCGCGGCCGAC
GACGAGACTCGACCGACGGTGGCCTGGCTGGCTAACAAGGCGGTCACGGTACCCTTGATGGCGCAGCAGCTGCTC
GACTCGCTGCAGAACAGGCCGCCGACGACGGTGCTGGCGTCTTGGCTGCCCTTTGACGTGCCCTTCGACCCGGGC
GTGGGATCGGTGCTCAACCTGGTCGTCTACATGGGACTGGCCCTGGTCTTCTTCCCTGCCTTCTTCGGCCTCTAT
CCCAGCGGAGAGCGCGTCGGCGGCGTCCGGGCCCTCCAATACTCCAACGGAGTCCGGCCTCTACCGCTATGGGCC
GCCTACGTCGCCTTCGACATGTCCGTCGTCCTCCCGGCCGCGGCGCTGGCCACGGCTCTCTGGGCGGCGCTGGCG
GCCGGATCTTGGTATCACGTCGGCTACGTCTTCGTCGTCCTGGCTCTGTACGGCCTGGCCTCGACAGAATTGGCC
TACCTGGTCTCCCTCTGGGCGCCGTCGCAGCTGGCGAGCTTTGCCTGGACGGCGTCGCTGCAGGCCGTCTTGTTC
CTCGTCTATCTCGTCGCCTACGTCTGTGTGCTGACGTACGTGAGCGTCGATCGCGTCGACGGCACGCTCCTCGTC
GCTCATTTCGTGCTGGCCGCCGTTGCGCCCATCTGCTCCGTCGTCCGCTCGCTCTTCGTCGTCACCAATCTCTTC
TCGACCGCCTGTGACGGCCGTCAGCCTTCGACGAATCCGGGAGGCCTGCTGCTGTACGGCGGACCGATGCTGTAC
CTGGCCATCCAGAGCATCGTCTTCTTCGGCCTGCTCCTCTGGTTCGACTCTTCCGGTCCGGGCCTCCTCTCATCA
TGTCATCCGAGGAGGGCCCGTCGCGGATCGACGGCCAGTGACGTCGATCATGATGAAGCCGTCGCCGCCGTCGCC
TCTCCTCCCGCGGGCCTCAGCGTCAGGAACCTCAGCAAGTCGTTCGGCCGTAACACAGCCGTCGACGACGTCTCC
TTCGACGTGAAACGCGGCGAAGTCTTTGCGCTGCTCGGTCCCAACGGCGCCGGAAAGTCGACGACCATGGCCCTG
ATCCGCGGAGACGAACGGCCCAGTCGCGGCCGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGAGGCGACGTCATG
ATCGGTCCCTTGTCGGTGACGCGTCGTCGAGCTGCGGCCAGGGCTCGCCTCGGAGTCTGTCCGCAGGCCGACGCT
CTGGATTCGTCCATGACGGTCCGTGAGCATCTCGACTTCTACGCCCGCGTCCGTGGCGTTCCGGACGCCCGTCAC
AACGTCGAGGAAGTCATCCGCGCCGTAGGACTGCAGTCCCTGTCTCGGCGGATGGCGACGGCGCTATCGGGAGGG
AACAAGCGGAAACTCAGCCTGGCCATCGCTCTCATGGGCAACCCTGCCGTCATCTTGCTCGACGAGCCTTCTTCG
GGCCTCGACGCAGCCGCCAAACGCGTCCTCTGGCCCGTCCTCGCCTCGACGGCAGTCGGACGGTCCATCCTCCTG
ACGACTCACAGCATGGAAGAGGCCGACGCCTTGGCTGCCCGGGCCGGAATCCTAGCCCGTCGAATGCTGGCCGTA
GGTTCCCTCGACGAGCTCCGTCGGAGAGCCGGTCATCGGCTTCACGTCCACCTCGTGGCCTCGTCAGCTCCGCGA
ACCACACGGGAAGAGATGGCCGCCATGACGGAATGGGTCCGCATCGCCATGCCCGACGCCGAGATGGAAGCTGCA
ACGTATCACGGCCAACTCCGCTTCGCCGTCCGAGCCCAAGACGTATCCTCGGCCTCTGAGAACCTCGCCCGTCAT
CACCAACTTCAGTCTCGGCCGCAAAAGCAACAGCCAAGCGTCACCACCGCCGAGCCCGATGAATCCTCCAAACCG
CTCACCCCGCGCGAAGAGAAACACGTCGTGCCGGACTCGGACCTCGACTCTGACTCTTCCGACGCGGCGACGACG
ACCACCACCACCACCACCACCACTGACTTCCTCCTCCCCCAATGTCCCACCACCACCACCACCACCACCACCACG
CTTCTCACGCTTCTTCTCTGGGCCGGCTGGTCGTCTTGCTCGAGAGGTACAAGGCCAGCCTGGGGATCGAGCACT
ATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail