Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01135
Gene name
Locationscaffold_01:4139621..4142111
Strand+
Gene length (bp)2490
Transcript length (bp)2367
Coding sequence length (bp)2367
Protein length (aa) 789

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 3.5E-31 386 499
PF10405 BHD_3 Rad4 beta-hairpin domain 3 4.2E-25 633 705
PF10403 BHD_1 Rad4 beta-hairpin domain 1 7.5E-22 505 560
PF10404 BHD_2 Rad4 beta-hairpin domain 2 7.9E-19 564 626

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3955 0.902 0.0569 0.0136 0.1543 0.0076 0.0334 0.0361 0.0468 0.0045

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3812
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3345
Ophiocordyceps australis map64 (Brazil) OphauB2|7020
Ophiocordyceps camponoti-floridani Ophcf2|01135 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3928
Ophiocordyceps kimflemingae Ophio5|2498
Ophiocordyceps subramaniannii Hirsu2|7460

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01135
MVGRKRAAATRGKRREDVSAADEEPDVYRQMLDEAGVTAHKGPAEETERPLKRRRPGSRQQNKSPLRKGEGSRPL
VADTEVEDDDDDDDDDDDDDDDEGVEFQDVILPEPTVQTMERESDDEEDDDMAFENEFAKFSDGVQPQEAKDLEL
NLTVPTTPTKGPAERRRPLTREEKTRRIDIHLHQTLRPLLSDKTIRYLTPGAHLPQFGQAESLKTGLQQAADMWK
TKFEICERGLRRSLWAEDPGQLDGYRLPGDMESCLDRTDFRDAARKLQGSRDVGAQLYCALLRSVGVRARLVCSL
QPLACVSGAPSMAKPNEKLRTPSKDKSHEALAKYEAMAGRITASSPSGSTARRRLGHPNAAAHDYKPAGRPPPSV
GPAFEAPIKIRESHHPVYWVEVLDAGHQKWQPADPLVTDSFWKPRALEPPSTDKENCLCYVVAMEADGTAKDVTR
RYAKAYTAKTRKLRIESALEDGEKWWSRVMKLYRRRRTTDLDQIEDAELAGVEAREPMPRNVQDFKDHPVFALQR
HLRRNEVLIPEAKPSGTIGAGSRGPLEKIYRRRDVRIARSVDKWFRLGRLVKANEIPAKWLPKKARPRRSSAGDA
ESEAADEDDAGTPIYRMDQTELYEPPAVCGGRVAKNKFGNIEVYVSSMIPKGAVHIVGQDVTRAALMAGIDYAPA
LTGFQFQGRHGTAVLSGIVVAAEFEEALRALMEGLAREEQERISEERRMALLAAWRRLLMGLRIRERIWSGVDLD
ERREAERQAEAEAGLGSSETTEEMDMEMDDEGGGFLVD*
Coding >Ophcf2|01135
ATGGTTGGACGGAAGCGCGCTGCTGCTACGAGAGGTAAAAGACGAGAGGATGTCTCTGCCGCCGACGAAGAACCC
GATGTTTACCGCCAGATGCTCGACGAAGCCGGCGTCACAGCCCACAAAGGCCCTGCCGAAGAGACGGAGAGGCCG
CTGAAGCGAAGGCGGCCTGGCTCTCGGCAGCAGAACAAATCCCCTCTTCGAAAAGGAGAGGGATCTCGACCGCTC
GTGGCCGATACCGAGGTCGAAGACGACGACGACGACGACGACGACGACGACGACGACGACGATGACGAGGGGGTC
GAGTTTCAAGACGTCATCCTGCCGGAGCCTACCGTTCAGACCATGGAGCGCGAATCCGACGATGAGGAAGACGAT
GATATGGCTTTTGAGAACGAATTCGCAAAGTTCAGCGACGGCGTTCAACCGCAAGAAGCCAAAGACCTCGAGCTC
AATCTCACGGTTCCCACGACGCCGACCAAAGGACCAGCAGAGCGACGCCGACCGTTGACCAGAGAGGAAAAGACA
CGACGCATAGACATACATCTGCACCAGACTCTTCGCCCGCTGCTCTCGGACAAGACGATACGCTATCTGACTCCC
GGGGCCCATCTACCGCAGTTCGGACAGGCCGAGAGCCTCAAAACAGGCCTGCAGCAAGCGGCAGACATGTGGAAG
ACCAAGTTTGAGATTTGCGAGCGCGGATTGAGGAGATCGCTATGGGCAGAGGATCCCGGGCAACTTGACGGTTAC
CGTCTTCCCGGCGATATGGAGTCTTGTCTGGACCGTACCGACTTTCGAGATGCGGCCAGGAAGCTTCAGGGATCC
CGAGACGTCGGCGCGCAGCTGTATTGCGCCCTCCTTCGCAGCGTCGGGGTTCGCGCGAGGCTCGTCTGTTCGCTA
CAGCCTCTTGCCTGCGTATCAGGGGCTCCATCCATGGCCAAGCCGAATGAGAAGCTGCGTACACCGAGCAAAGAC
AAGTCGCACGAAGCATTGGCCAAGTACGAGGCCATGGCCGGCAGGATAACCGCATCGTCTCCGAGCGGATCCACG
GCCAGACGCCGGCTGGGCCATCCGAACGCAGCAGCTCACGATTACAAGCCCGCTGGCCGGCCCCCGCCGTCAGTC
GGGCCGGCTTTTGAGGCGCCGATCAAGATACGCGAGTCGCATCATCCCGTCTACTGGGTCGAGGTGCTGGATGCC
GGGCATCAGAAGTGGCAGCCGGCCGATCCCCTGGTCACGGATAGCTTCTGGAAGCCCAGAGCATTGGAGCCCCCA
TCCACGGATAAGGAGAATTGTCTCTGCTATGTGGTGGCGATGGAAGCCGATGGGACGGCCAAAGACGTGACGAGG
AGGTACGCCAAGGCATACACGGCCAAGACGCGCAAGCTGCGGATCGAGAGCGCGCTCGAGGACGGAGAAAAGTGG
TGGAGCCGAGTCATGAAGCTATATAGACGAAGACGGACGACGGACCTGGACCAGATCGAGGACGCGGAACTCGCC
GGGGTCGAGGCCAGAGAACCGATGCCGCGGAACGTGCAGGATTTCAAAGACCACCCGGTCTTCGCTCTCCAAAGA
CACCTGCGGCGCAACGAAGTGCTGATTCCCGAAGCCAAGCCATCCGGGACCATCGGCGCCGGGAGCCGAGGCCCC
TTGGAGAAGATTTACCGGCGCCGGGATGTACGAATCGCTCGAAGCGTCGACAAGTGGTTCCGTCTGGGACGGCTG
GTCAAGGCCAACGAGATACCGGCCAAGTGGTTGCCCAAGAAAGCTCGGCCCAGACGTTCCTCGGCGGGAGACGCC
GAGTCGGAGGCAGCGGACGAGGACGACGCCGGAACGCCCATCTACAGGATGGACCAGACGGAGCTGTACGAGCCG
CCGGCGGTGTGTGGCGGGCGAGTGGCCAAGAACAAGTTTGGCAATATCGAGGTCTACGTGTCCAGCATGATCCCC
AAGGGAGCGGTACACATTGTCGGACAAGACGTCACGAGGGCCGCCCTGATGGCAGGTATCGATTACGCGCCGGCG
CTGACGGGATTTCAGTTTCAGGGCCGCCACGGCACCGCGGTATTGAGCGGAATCGTGGTGGCGGCGGAGTTTGAG
GAGGCGCTGCGGGCGCTGATGGAAGGCCTGGCTCGGGAGGAGCAGGAGCGCATCTCGGAGGAGCGACGTATGGCG
CTGCTGGCTGCATGGCGCAGGCTTCTAATGGGGCTGAGAATCCGCGAGAGGATCTGGAGCGGCGTCGATTTGGAC
GAGAGGCGCGAAGCCGAGAGGCAGGCCGAAGCGGAAGCCGGCTTGGGATCGAGCGAGACGACGGAGGAGATGGAC
ATGGAAATGGATGACGAGGGAGGCGGCTTCCTGGTCGACTAG
Transcript >Ophcf2|01135
ATGGTTGGACGGAAGCGCGCTGCTGCTACGAGAGGTAAAAGACGAGAGGATGTCTCTGCCGCCGACGAAGAACCC
GATGTTTACCGCCAGATGCTCGACGAAGCCGGCGTCACAGCCCACAAAGGCCCTGCCGAAGAGACGGAGAGGCCG
CTGAAGCGAAGGCGGCCTGGCTCTCGGCAGCAGAACAAATCCCCTCTTCGAAAAGGAGAGGGATCTCGACCGCTC
GTGGCCGATACCGAGGTCGAAGACGACGACGACGACGACGACGACGACGACGACGACGACGATGACGAGGGGGTC
GAGTTTCAAGACGTCATCCTGCCGGAGCCTACCGTTCAGACCATGGAGCGCGAATCCGACGATGAGGAAGACGAT
GATATGGCTTTTGAGAACGAATTCGCAAAGTTCAGCGACGGCGTTCAACCGCAAGAAGCCAAAGACCTCGAGCTC
AATCTCACGGTTCCCACGACGCCGACCAAAGGACCAGCAGAGCGACGCCGACCGTTGACCAGAGAGGAAAAGACA
CGACGCATAGACATACATCTGCACCAGACTCTTCGCCCGCTGCTCTCGGACAAGACGATACGCTATCTGACTCCC
GGGGCCCATCTACCGCAGTTCGGACAGGCCGAGAGCCTCAAAACAGGCCTGCAGCAAGCGGCAGACATGTGGAAG
ACCAAGTTTGAGATTTGCGAGCGCGGATTGAGGAGATCGCTATGGGCAGAGGATCCCGGGCAACTTGACGGTTAC
CGTCTTCCCGGCGATATGGAGTCTTGTCTGGACCGTACCGACTTTCGAGATGCGGCCAGGAAGCTTCAGGGATCC
CGAGACGTCGGCGCGCAGCTGTATTGCGCCCTCCTTCGCAGCGTCGGGGTTCGCGCGAGGCTCGTCTGTTCGCTA
CAGCCTCTTGCCTGCGTATCAGGGGCTCCATCCATGGCCAAGCCGAATGAGAAGCTGCGTACACCGAGCAAAGAC
AAGTCGCACGAAGCATTGGCCAAGTACGAGGCCATGGCCGGCAGGATAACCGCATCGTCTCCGAGCGGATCCACG
GCCAGACGCCGGCTGGGCCATCCGAACGCAGCAGCTCACGATTACAAGCCCGCTGGCCGGCCCCCGCCGTCAGTC
GGGCCGGCTTTTGAGGCGCCGATCAAGATACGCGAGTCGCATCATCCCGTCTACTGGGTCGAGGTGCTGGATGCC
GGGCATCAGAAGTGGCAGCCGGCCGATCCCCTGGTCACGGATAGCTTCTGGAAGCCCAGAGCATTGGAGCCCCCA
TCCACGGATAAGGAGAATTGTCTCTGCTATGTGGTGGCGATGGAAGCCGATGGGACGGCCAAAGACGTGACGAGG
AGGTACGCCAAGGCATACACGGCCAAGACGCGCAAGCTGCGGATCGAGAGCGCGCTCGAGGACGGAGAAAAGTGG
TGGAGCCGAGTCATGAAGCTATATAGACGAAGACGGACGACGGACCTGGACCAGATCGAGGACGCGGAACTCGCC
GGGGTCGAGGCCAGAGAACCGATGCCGCGGAACGTGCAGGATTTCAAAGACCACCCGGTCTTCGCTCTCCAAAGA
CACCTGCGGCGCAACGAAGTGCTGATTCCCGAAGCCAAGCCATCCGGGACCATCGGCGCCGGGAGCCGAGGCCCC
TTGGAGAAGATTTACCGGCGCCGGGATGTACGAATCGCTCGAAGCGTCGACAAGTGGTTCCGTCTGGGACGGCTG
GTCAAGGCCAACGAGATACCGGCCAAGTGGTTGCCCAAGAAAGCTCGGCCCAGACGTTCCTCGGCGGGAGACGCC
GAGTCGGAGGCAGCGGACGAGGACGACGCCGGAACGCCCATCTACAGGATGGACCAGACGGAGCTGTACGAGCCG
CCGGCGGTGTGTGGCGGGCGAGTGGCCAAGAACAAGTTTGGCAATATCGAGGTCTACGTGTCCAGCATGATCCCC
AAGGGAGCGGTACACATTGTCGGACAAGACGTCACGAGGGCCGCCCTGATGGCAGGTATCGATTACGCGCCGGCG
CTGACGGGATTTCAGTTTCAGGGCCGCCACGGCACCGCGGTATTGAGCGGAATCGTGGTGGCGGCGGAGTTTGAG
GAGGCGCTGCGGGCGCTGATGGAAGGCCTGGCTCGGGAGGAGCAGGAGCGCATCTCGGAGGAGCGACGTATGGCG
CTGCTGGCTGCATGGCGCAGGCTTCTAATGGGGCTGAGAATCCGCGAGAGGATCTGGAGCGGCGTCGATTTGGAC
GAGAGGCGCGAAGCCGAGAGGCAGGCCGAAGCGGAAGCCGGCTTGGGATCGAGCGAGACGACGGAGGAGATGGAC
ATGGAAATGGATGACGAGGGAGGCGGCTTCCTGGTCGACTAG
Gene >Ophcf2|01135
ATGGTTGGACGGAAGCGCGCTGCTGCTACGAGAGGTAAAAGACGAGAGGATGTCTCTGCCGCCGACGAAGAACCC
GATGTTTACCGCCAGATGCTCGACGAAGCCGGCGTCACAGCCCACAAAGGCCCTGCCGAAGAGACGGAGAGGCCG
CTGAAGCGAAGGCGGCCTGGCTCTCGGCAGCAGAACAAATCCCCTCTTCGAAAAGGAGAGGGATCTCGACCGCTC
GTGGCCGATACCGAGGTCGAAGACGACGACGACGACGACGACGACGACGACGACGACGACGATGACGAGGGGGTC
GAGTTTCAAGACGTCATCCTGCCGGAGCCTACCGTTCAGACCATGGAGCGCGAATCCGACGATGAGGAAGACGAT
GATATGGCTTTTGAGAACGAATTCGCAAAGTTCAGCGACGGCGTTCAACCGCAAGAAGCCAAAGACCTCGAGCTC
AATCTCACGGTTCCCACGACGCCGACCAAAGGACCAGCAGAGCGACGCCGACCGTTGACCAGAGAGGAAAAGACA
CGACGCATAGACATACATCGTACGCACCTTGTATGCTTGTTGTCGCATATCTCGCGACGAAATCACTGGTGCAAC
GACGCCAAAGTGCACCAGACTCTTCGCCCGCTGCTCTCGGACAAGACGATACGCTATCTGACTCCCGGGGCCCAT
CTACCGCAGTTCGGACAGGCCGAGAGCCTCAAAACAGGCCTGCAGCAAGCGGCAGACATGTGGAAGACCAAGTTT
GAGATTTGCGAGCGCGGATTGAGGAGATCGCTATGGGCAGAGGATCCCGGGCAACTTGACGGTGTGGGTGTTTGC
GCCATCCCTCATCCTACTGTAAAGAAGCGCTGACGCCCTTCTCAGTACCGTCTTCCCGGCGATATGGAGTCTTGT
CTGGACCGTACCGACTTTCGAGATGCGGCCAGGAAGCTTCAGGGATCCCGAGACGTCGGCGCGCAGCTGTATTGC
GCCCTCCTTCGCAGCGTCGGGGTTCGCGCGAGGCTCGTCTGTTCGCTACAGCCTCTTGCCTGCGTATCAGGGGCT
CCATCCATGGCCAAGCCGAATGAGAAGCTGCGTACACCGAGCAAAGACAAGTCGCACGAAGCATTGGCCAAGTAC
GAGGCCATGGCCGGCAGGATAACCGCATCGTCTCCGAGCGGATCCACGGCCAGACGCCGGCTGGGCCATCCGAAC
GCAGCAGCTCACGATTACAAGCCCGCTGGCCGGCCCCCGCCGTCAGTCGGGCCGGCTTTTGAGGCGCCGATCAAG
ATACGCGAGTCGCATCATCCCGTCTACTGGGTCGAGGTGCTGGATGCCGGGCATCAGAAGTGGCAGCCGGCCGAT
CCCCTGGTCACGGATAGCTTCTGGAAGCCCAGAGCATTGGAGCCCCCATCCACGGATAAGGAGAATTGTCTCTGC
TATGTGGTGGCGATGGAAGCCGATGGGACGGCCAAAGACGTGACGAGGAGGTACGCCAAGGCATACACGGCCAAG
ACGCGCAAGCTGCGGATCGAGAGCGCGCTCGAGGACGGAGAAAAGTGGTGGAGCCGAGTCATGAAGCTATATAGA
CGAAGACGGACGACGGACCTGGACCAGATCGAGGACGCGGAACTCGCCGGGGTCGAGGCCAGAGAACCGATGCCG
CGGAACGTGCAGGATTTCAAAGACCACCCGGTCTTCGCTCTCCAAAGACACCTGCGGCGCAACGAAGTGCTGATT
CCCGAAGCCAAGCCATCCGGGACCATCGGCGCCGGGAGCCGAGGCCCCTTGGAGAAGATTTACCGGCGCCGGGAT
GTACGAATCGCTCGAAGCGTCGACAAGTGGTTCCGTCTGGGACGGCTGGTCAAGGCCAACGAGATACCGGCCAAG
TGGTTGCCCAAGAAAGCTCGGCCCAGACGTTCCTCGGCGGGAGACGCCGAGTCGGAGGCAGCGGACGAGGACGAC
GCCGGAACGCCCATCTACAGGATGGACCAGACGGAGCTGTACGAGCCGCCGGCGGTGTGTGGCGGGCGAGTGGCC
AAGAACAAGTTTGGCAATATCGAGGTCTACGTGTCCAGCATGATCCCCAAGGGAGCGGTACACATTGTCGGACAA
GACGTCACGAGGGCCGCCCTGATGGCAGGTATCGATTACGCGCCGGCGCTGACGGGATTTCAGTTTCAGGGCCGC
CACGGCACCGCGGTATTGAGCGGAATCGTGGTGGCGGCGGAGTTTGAGGAGGCGCTGCGGGCGCTGATGGAAGGC
CTGGCTCGGGAGGAGCAGGAGCGCATCTCGGAGGAGCGACGTATGGCGCTGCTGGCTGCATGGCGCAGGCTTCTA
ATGGGGCTGAGAATCCGCGAGAGGATCTGGAGCGGCGTCGATTTGGACGAGAGGCGCGAAGCCGAGAGGCAGGCC
GAAGCGGAAGCCGGCTTGGGATCGAGCGAGACGACGGAGGAGATGGACATGGAAATGGATGACGAGGGAGGCGGC
TTCCTGGTCGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail