Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01131
Gene name
Locationscaffold_01:4129324..4130848
Strand+
Gene length (bp)1524
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2518 0.8307 0.1699 0.0113 0.0757 0.02 0.0599 0.0081 0.0068 0.0018

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1307
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3340
Ophiocordyceps australis map64 (Brazil) OphauB2|7015
Ophiocordyceps camponoti-floridani Ophcf2|01131 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3932
Ophiocordyceps kimflemingae Ophio5|2494
Ophiocordyceps subramaniannii Hirsu2|1063

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01131
MPPLGPAPETDYVRLHITPLDADLANVIIPASVRPRSRNLSFHTIETFPDKPYGFVELPRMDADRLKNKLNGSLL
KGSRIRVEDARPVERVEPTGGAARPEKKRKMSADKAPDSSSKSRHPNSLDGLLLKDRKVKRGWTETPSAKKKTAK
DGQKRQKSRYTDKEECLLKLKVPPNATANLPAATKKNKKKSRDVVVHEFEKTTKFPNFLKTAAPDTDGKAATEYV
EGKGWVDEDGRVMEKVKDRRAVEAAVSVARGEEGSGGIAGSGVTSPDEASDDDDTSSSGTSSEDETEDDDAQESP
CSSREQAQKSCPTGKGAKEGSSPPPSSPKSLTIKIPRLEPHPSVHPLEALYKRPPPGSETAEAASQPEPFSFFGG
PPGDEDDTQAAAAEKPATHPASKMPMTPFTRQDFERRGIRSAAPTPDTAHPSRRHLFWASKVDADAEADGGHDDD
DEEDFEGAPPPKEGQSDFQSWFWENRRELNRSWMTRRKTVAKERRHRENQARTSKAA*
Coding >Ophcf2|01131
ATGCCGCCCCTCGGACCAGCCCCGGAGACCGATTACGTCCGCTTACACATCACGCCTCTAGACGCAGACCTCGCC
AACGTCATCATTCCAGCCTCTGTCCGTCCGCGCTCGCGCAATCTCTCCTTCCACACGATTGAAACCTTCCCCGAT
AAGCCATACGGCTTTGTCGAGCTGCCGCGCATGGACGCCGACCGCCTGAAGAACAAGCTCAACGGCTCGCTCCTC
AAGGGCTCTCGCATTCGTGTTGAGGACGCTCGTCCGGTGGAGCGCGTTGAGCCGACGGGTGGCGCCGCTCGTCCT
GAGAAGAAGCGCAAGATGTCAGCGGATAAAGCTCCTGACTCGAGCAGCAAGTCAAGACACCCTAACTCTCTGGAC
GGTCTTCTTCTCAAGGATAGAAAGGTGAAGCGCGGCTGGACCGAGACGCCTAGCGCGAAGAAGAAGACCGCGAAG
GATGGCCAGAAGCGACAAAAATCACGCTACACCGACAAGGAGGAGTGTCTGCTCAAGCTCAAGGTTCCGCCCAAC
GCCACCGCCAATCTGCCGGCTGCGACCAAGAAGAACAAGAAAAAGTCGCGAGATGTGGTGGTTCACGAGTTCGAG
AAGACGACAAAGTTCCCCAACTTTCTAAAGACGGCTGCTCCCGATACGGACGGCAAGGCAGCAACCGAGTACGTC
GAGGGCAAGGGCTGGGTCGACGAGGACGGCAGAGTGATGGAGAAAGTCAAGGACAGAAGAGCGGTGGAAGCGGCC
GTCTCTGTCGCCCGTGGCGAGGAGGGATCAGGTGGCATCGCAGGCAGCGGCGTTACCTCTCCCGACGAAGCATCA
GACGACGACGACACCAGCAGCAGCGGCACTTCCTCTGAAGACGAGACCGAAGACGATGACGCCCAAGAGTCTCCT
TGTTCAAGCCGTGAGCAGGCGCAAAAATCTTGTCCCACCGGAAAGGGAGCAAAAGAAGGCTCATCCCCCCCGCCA
AGCTCCCCGAAAAGCCTGACCATCAAAATCCCCCGGCTCGAGCCCCATCCCTCCGTCCACCCGCTGGAAGCACTC
TACAAGCGCCCGCCACCCGGCTCTGAAACCGCCGAGGCAGCCTCCCAGCCCGAACCGTTCAGCTTCTTCGGCGGT
CCCCCAGGCGATGAAGACGACACGCAGGCAGCAGCGGCAGAGAAGCCAGCCACCCATCCCGCCTCCAAGATGCCC
ATGACACCCTTTACCAGGCAGGATTTCGAGCGACGGGGCATCCGCAGCGCGGCACCGACGCCCGACACGGCCCAC
CCGTCGAGGAGACACCTCTTCTGGGCCTCAAAGGTAGACGCCGACGCGGAGGCAGATGGGGGCCACGACGACGAT
GACGAGGAGGACTTTGAGGGTGCGCCTCCCCCGAAGGAGGGCCAGAGCGACTTTCAGTCTTGGTTCTGGGAGAAC
AGGCGCGAGCTCAATCGGTCGTGGATGACGCGTCGTAAGACGGTGGCCAAGGAGAGGCGTCACCGGGAGAATCAG
GCGAGGACGTCCAAGGCAGCATAG
Transcript >Ophcf2|01131
ATGCCGCCCCTCGGACCAGCCCCGGAGACCGATTACGTCCGCTTACACATCACGCCTCTAGACGCAGACCTCGCC
AACGTCATCATTCCAGCCTCTGTCCGTCCGCGCTCGCGCAATCTCTCCTTCCACACGATTGAAACCTTCCCCGAT
AAGCCATACGGCTTTGTCGAGCTGCCGCGCATGGACGCCGACCGCCTGAAGAACAAGCTCAACGGCTCGCTCCTC
AAGGGCTCTCGCATTCGTGTTGAGGACGCTCGTCCGGTGGAGCGCGTTGAGCCGACGGGTGGCGCCGCTCGTCCT
GAGAAGAAGCGCAAGATGTCAGCGGATAAAGCTCCTGACTCGAGCAGCAAGTCAAGACACCCTAACTCTCTGGAC
GGTCTTCTTCTCAAGGATAGAAAGGTGAAGCGCGGCTGGACCGAGACGCCTAGCGCGAAGAAGAAGACCGCGAAG
GATGGCCAGAAGCGACAAAAATCACGCTACACCGACAAGGAGGAGTGTCTGCTCAAGCTCAAGGTTCCGCCCAAC
GCCACCGCCAATCTGCCGGCTGCGACCAAGAAGAACAAGAAAAAGTCGCGAGATGTGGTGGTTCACGAGTTCGAG
AAGACGACAAAGTTCCCCAACTTTCTAAAGACGGCTGCTCCCGATACGGACGGCAAGGCAGCAACCGAGTACGTC
GAGGGCAAGGGCTGGGTCGACGAGGACGGCAGAGTGATGGAGAAAGTCAAGGACAGAAGAGCGGTGGAAGCGGCC
GTCTCTGTCGCCCGTGGCGAGGAGGGATCAGGTGGCATCGCAGGCAGCGGCGTTACCTCTCCCGACGAAGCATCA
GACGACGACGACACCAGCAGCAGCGGCACTTCCTCTGAAGACGAGACCGAAGACGATGACGCCCAAGAGTCTCCT
TGTTCAAGCCGTGAGCAGGCGCAAAAATCTTGTCCCACCGGAAAGGGAGCAAAAGAAGGCTCATCCCCCCCGCCA
AGCTCCCCGAAAAGCCTGACCATCAAAATCCCCCGGCTCGAGCCCCATCCCTCCGTCCACCCGCTGGAAGCACTC
TACAAGCGCCCGCCACCCGGCTCTGAAACCGCCGAGGCAGCCTCCCAGCCCGAACCGTTCAGCTTCTTCGGCGGT
CCCCCAGGCGATGAAGACGACACGCAGGCAGCAGCGGCAGAGAAGCCAGCCACCCATCCCGCCTCCAAGATGCCC
ATGACACCCTTTACCAGGCAGGATTTCGAGCGACGGGGCATCCGCAGCGCGGCACCGACGCCCGACACGGCCCAC
CCGTCGAGGAGACACCTCTTCTGGGCCTCAAAGGTAGACGCCGACGCGGAGGCAGATGGGGGCCACGACGACGAT
GACGAGGAGGACTTTGAGGGTGCGCCTCCCCCGAAGGAGGGCCAGAGCGACTTTCAGTCTTGGTTCTGGGAGAAC
AGGCGCGAGCTCAATCGGTCGTGGATGACGCGTCGTAAGACGGTGGCCAAGGAGAGGCGTCACCGGGAGAATCAG
GCGAGGACGTCCAAGGCAGCATAG
Gene >Ophcf2|01131
ATGCCGCCCCTCGGACCAGCCCCGGAGACCGATTACGTCCGCTTACACATCACGCCTCTAGACGCAGACCTCGCC
AACGTCATCATTCCAGCCTCTGTCCGTCCGCGCTCGCGCAATCTCTCCTTCCACACGATTGAAACCTTCCCCGAT
AAGCCATACGGCTTTGTCGAGCTGCCGCGCATGGACGCCGACCGCCTGAAGAACAAGCTCAACGGCTCGCTCCTC
AAGGGCTCTCGCATTCGTGTTGAGGACGCTCGTCCGGTGGAGCGCGTTGAGCCGACGGGTGGCGCCGCTCGTCCT
GAGAAGAAGCGCAAGATGTCAGCGGATAAAGCTCCTGACTCGAGCAGCAAGTCAAGACACCCTAACTCTCTGGAC
GGTCTTCTTCTCAAGGATAGAAAGGTGAAGCGCGGCTGGACCGAGACGCCTAGCGCGAAGAAGAAGACCGCGAAG
GATGGCCAGAAGCGACAAAAATCACGCTACACCGACAAGGAGGAGTGTCTGCTCAAGCTCAAGGTTCCGCCCAAC
GCCACCGCCAATCTGCCGGCTGCGACCAAGAAGAACAAGAAAAAGTCGCGAGATGTGGTGGTTCACGAGTTCGAG
AAGACGACAAAGTTCCCCAACTTTCTAAAGACGGCTGCTCCCGATACGGACGGCAAGGCAGCAACCGAGTACGTC
GAGGGCAAGGGCTGGGTCGACGAGGACGGCAGAGTGATGGAGAAAGTCAAGGACAGAAGAGCGGTGGAAGCGGCC
GTCTCTGTCGCCCGTGGCGAGGAGGGATCAGGTGGCATCGCAGGCAGCGGCGTTACCTCTCCCGACGAAGCATCA
GACGACGACGACACCAGCAGCAGCGGCACTTCCTCTGAAGACGAGACCGAAGACGATGACGCCCAAGAGTCTCCT
TGTTCAAGCCGTGAGCAGGCGCAAAAATCTTGTCCCACCGGAAAGGGAGCAAAAGAAGGCTCATCCCCCCCGCCA
AGCTCCCCGAAAAGCCTGACCATCAAAATCCCCCGGCTCGAGCCCCATCCCTCCGTCCACCCGCTGGAAGCACTC
TACAAGCGCCCGCCACCCGGCTCTGAAACCGCCGAGGCAGCCTCCCAGCCCGAACCGTTCAGCTTCTTCGGCGGT
CCCCCAGGCGATGAAGACGACACGCAGGCAGCAGCGGCAGAGAAGCCAGCCACCCATCCCGCCTCCAAGATGCCC
ATGACACCCTTTACCAGGCAGGATTTCGAGCGACGGGGCATCCGCAGCGCGGCACCGACGCCCGACACGGCCCAC
CCGTCGAGGAGACACCTCTTCTGGGCCTCAAAGGTAGACGCCGACGCGGAGGCAGATGGGGGCCACGACGACGAT
GACGAGGAGGACTTTGAGGGTGCGCCTCCCCCGAAGGAGGGCCAGAGCGACTTTCAGTCTTGGTTCTGGGAGAAC
AGGCGCGAGCTCAATCGGTCGTGGATGACGCGTCGTAAGACGGTGGCCAAGGAGAGGCGTCACCGGGAGAATCAG
GCGAGGACGTCCAAGGCAGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail