Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01129
Gene name
Locationscaffold_01:4122536..4125779
Strand-
Gene length (bp)3243
Transcript length (bp)2631
Coding sequence length (bp)2631
Protein length (aa) 877

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 6.4E-169 152 840

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

Domain # Start End Length
1 266 285 19
2 295 317 22
3 338 360 22
4 375 394 19
5 415 437 22
6 488 507 19
7 564 586 22
8 591 613 22
9 620 642 22
10 672 694 22
11 738 760 22
12 785 807 22
13 819 841 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.83 0.11 1.54
Alive In ants, during behavior modification 1.41 0.23 2.59
Dead In ants, recently dead 0.42 0.00 0.85

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.173518 no
Alive Dead 0.000238 yes
Dead Fungus 0.110721 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01129
MPTRKVRVDEDQATMKEAMENGRGSNKGDKAIILEKMPSDDAETTGSLKHLDATEDDILEARELAASMSLETVHG
MMKKVLADHENDPNFNHATVEVIKTFLSDQDVLLNPEKHEQLVERIKLEAALIATNSPYAEVRANVDNHDKADMP
VSTIRAWTLGCLFSVLLSFVNQLFSVRQPSIKFETNVAQLLSYPLGKCWERWMPRYDVPIPFTGRSVSLNPGPFN
KKEHMLIAIMANTSKSLPYTNFMIWTQVLPQGFNQQYARSAGYMFLNAFATNFIGYGLAGVMRKILVKPAYCIWP
TVFSTIALNAALHPGAGDETKTVRGPMRTTWTMSRYRFFLYTFFAMLVYFWFPNYLFQALSYFSWMTWIAPDNLT
LNIFTGMQNGLGLFNPFPTFDWNCMTYITDPLMLPSTTTFNAVGGMFLTGLLIPIAWFTNTWNTGYLPILTNRVH
DHFGKLYNISNTLDSRGMFDAEKYAEYSRPYLGAANALAYGWHFAIYTAIITHVLLYHRSQMMMGFKSIFKSLRC
AFYRRKKKTDRSAGDAVQEERYPDVHNRLMSVYAEIPEWWFCLILAISILLGILGIVLWPTYTSPAVVLYGILLC
LLFIVPIGVTVSMTGMEITLNVLAEFIGGVIVEGNALAMNFFKSYGYITCAHAISFLQDLKIAHYVKIPPRVTFM
GQMVATLISTTVCTGVFMFQMNIKDVCTASAPMRFFCPGPNTFMTASVLWGTIGPIKVFGKEGYYKWLLMGFPVG
FLLVSIVWALQRRYPDSGFLRRINVVVAIAGSLQWAPYSFSYAWPALPVAWYSWIYVRSRHLNFWSRYNYVLSAS
LSAGVAISAIIMLFTVQWAGINVNWWGNSQPFKGCEGEPCRLYKLAEGERF*
Coding >Ophcf2|01129
ATGCCGACTCGCAAGGTCAGAGTCGACGAAGACCAGGCTACGATGAAAGAGGCAATGGAGAACGGCCGAGGGAGC
AACAAGGGCGACAAAGCCATCATCCTGGAGAAGATGCCCTCGGACGATGCCGAGACGACTGGTAGCCTCAAACAC
CTCGATGCTACCGAGGATGATATTCTCGAGGCTAGGGAGTTGGCGGCCTCGATGAGCCTGGAGACGGTCCATGGA
ATGATGAAGAAGGTGTTGGCAGACCACGAGAACGATCCCAACTTCAACCACGCCACTGTCGAGGTCATCAAGACG
TTTCTGTCCGACCAAGATGTCCTCCTCAACCCGGAGAAGCACGAGCAACTCGTGGAGCGGATCAAGCTCGAAGCA
GCCCTCATCGCGACCAACAGCCCCTACGCCGAGGTCCGAGCCAACGTCGACAACCACGACAAGGCCGACATGCCC
GTCTCGACCATCCGGGCCTGGACGCTGGGCTGCCTCTTCAGCGTGCTCCTCTCCTTCGTCAACCAGCTCTTCTCG
GTCCGGCAGCCGTCCATCAAGTTCGAGACCAACGTCGCCCAGTTGCTATCGTACCCGCTGGGAAAGTGCTGGGAG
AGATGGATGCCCCGTTACGATGTGCCCATCCCCTTTACCGGCCGCAGCGTGAGCCTCAATCCGGGACCGTTTAAT
AAGAAGGAGCATATGCTCATCGCCATCATGGCCAACACGTCCAAGAGCCTTCCGTACACCAACTTCATGATCTGG
ACGCAGGTGTTGCCCCAGGGCTTTAACCAGCAGTACGCTCGCAGCGCGGGATACATGTTCCTCAACGCCTTTGCT
ACCAATTTCATCGGTTACGGGTTGGCCGGCGTCATGCGTAAGATCCTCGTCAAGCCGGCTTATTGCATCTGGCCG
ACCGTCTTCTCGACCATTGCTCTCAACGCGGCACTGCATCCGGGGGCAGGGGATGAGACCAAGACGGTCAGAGGG
CCGATGCGAACGACGTGGACCATGTCTCGTTACCGGTTCTTCCTCTACACCTTCTTCGCCATGCTCGTGTACTTT
TGGTTCCCCAACTATCTGTTTCAGGCCTTGTCGTACTTTTCGTGGATGACGTGGATTGCGCCGGACAACCTGACG
CTGAACATCTTTACGGGGATGCAGAATGGGCTCGGGCTGTTCAACCCCTTTCCGACCTTTGACTGGAACTGCATG
ACCTACATCACCGATCCTCTGATGCTCCCCTCCACCACAACCTTCAACGCCGTGGGCGGCATGTTCCTCACCGGC
CTCCTGATCCCCATTGCTTGGTTCACAAACACCTGGAACACGGGCTACCTGCCCATCCTCACGAATCGAGTGCAC
GATCACTTCGGTAAGCTGTACAACATCTCCAACACCCTCGACTCGCGCGGCATGTTCGACGCCGAAAAGTACGCC
GAGTATTCGCGTCCTTACCTCGGGGCCGCCAACGCGTTGGCCTATGGCTGGCACTTTGCCATTTATACGGCCATT
ATAACGCACGTGCTGCTCTATCACAGGTCTCAGATGATGATGGGTTTCAAGAGCATCTTCAAGAGTCTTCGCTGT
GCATTCTATAGGAGGAAGAAGAAGACGGATCGGAGTGCCGGTGACGCCGTTCAGGAGGAGAGATACCCAGACGTC
CACAACCGCCTGATGTCGGTATACGCAGAGATTCCCGAATGGTGGTTCTGCCTCATCCTGGCCATCTCCATCTTA
CTGGGCATCCTCGGAATCGTCCTCTGGCCGACCTACACCTCGCCCGCCGTCGTCCTCTACGGCATCCTTCTATGC
CTTCTCTTCATCGTCCCCATCGGCGTGACGGTTAGCATGACGGGCATGGAGATTACGCTCAACGTGCTAGCCGAG
TTCATTGGAGGCGTCATCGTCGAGGGCAACGCGCTGGCCATGAACTTTTTCAAGTCTTACGGGTACATTACTTGT
GCACACGCCATTTCCTTTCTCCAGGACCTCAAGATAGCTCATTATGTCAAGATCCCTCCCCGGGTCACCTTCATG
GGCCAGATGGTAGCCACGCTGATCTCGACCACTGTCTGCACCGGTGTCTTCATGTTCCAGATGAACATCAAGGAC
GTCTGCACCGCCTCAGCCCCCATGAGGTTCTTCTGCCCCGGTCCCAACACCTTCATGACGGCTTCCGTCCTCTGG
GGCACCATCGGCCCCATAAAGGTATTCGGCAAGGAAGGCTACTACAAGTGGCTCCTGATGGGCTTCCCCGTCGGC
TTCCTCCTCGTCTCCATCGTCTGGGCCCTGCAGAGGCGTTATCCAGACTCGGGCTTCCTTCGACGGATCAACGTC
GTCGTCGCCATCGCCGGTTCGCTACAGTGGGCTCCCTATAGCTTCTCTTACGCGTGGCCGGCGCTGCCCGTCGCC
TGGTACTCGTGGATCTACGTCCGCAGCCGCCATCTCAACTTCTGGTCACGATACAACTACGTTCTCTCGGCCTCG
CTCTCGGCCGGCGTCGCCATCTCCGCCATAATCATGCTCTTCACCGTCCAGTGGGCCGGTATCAATGTCAACTGG
TGGGGGAACTCTCAGCCGTTCAAGGGTTGCGAGGGTGAGCCTTGCCGGCTGTATAAGCTGGCTGAAGGGGAGAGG
TTCTGA
Transcript >Ophcf2|01129
ATGCCGACTCGCAAGGTCAGAGTCGACGAAGACCAGGCTACGATGAAAGAGGCAATGGAGAACGGCCGAGGGAGC
AACAAGGGCGACAAAGCCATCATCCTGGAGAAGATGCCCTCGGACGATGCCGAGACGACTGGTAGCCTCAAACAC
CTCGATGCTACCGAGGATGATATTCTCGAGGCTAGGGAGTTGGCGGCCTCGATGAGCCTGGAGACGGTCCATGGA
ATGATGAAGAAGGTGTTGGCAGACCACGAGAACGATCCCAACTTCAACCACGCCACTGTCGAGGTCATCAAGACG
TTTCTGTCCGACCAAGATGTCCTCCTCAACCCGGAGAAGCACGAGCAACTCGTGGAGCGGATCAAGCTCGAAGCA
GCCCTCATCGCGACCAACAGCCCCTACGCCGAGGTCCGAGCCAACGTCGACAACCACGACAAGGCCGACATGCCC
GTCTCGACCATCCGGGCCTGGACGCTGGGCTGCCTCTTCAGCGTGCTCCTCTCCTTCGTCAACCAGCTCTTCTCG
GTCCGGCAGCCGTCCATCAAGTTCGAGACCAACGTCGCCCAGTTGCTATCGTACCCGCTGGGAAAGTGCTGGGAG
AGATGGATGCCCCGTTACGATGTGCCCATCCCCTTTACCGGCCGCAGCGTGAGCCTCAATCCGGGACCGTTTAAT
AAGAAGGAGCATATGCTCATCGCCATCATGGCCAACACGTCCAAGAGCCTTCCGTACACCAACTTCATGATCTGG
ACGCAGGTGTTGCCCCAGGGCTTTAACCAGCAGTACGCTCGCAGCGCGGGATACATGTTCCTCAACGCCTTTGCT
ACCAATTTCATCGGTTACGGGTTGGCCGGCGTCATGCGTAAGATCCTCGTCAAGCCGGCTTATTGCATCTGGCCG
ACCGTCTTCTCGACCATTGCTCTCAACGCGGCACTGCATCCGGGGGCAGGGGATGAGACCAAGACGGTCAGAGGG
CCGATGCGAACGACGTGGACCATGTCTCGTTACCGGTTCTTCCTCTACACCTTCTTCGCCATGCTCGTGTACTTT
TGGTTCCCCAACTATCTGTTTCAGGCCTTGTCGTACTTTTCGTGGATGACGTGGATTGCGCCGGACAACCTGACG
CTGAACATCTTTACGGGGATGCAGAATGGGCTCGGGCTGTTCAACCCCTTTCCGACCTTTGACTGGAACTGCATG
ACCTACATCACCGATCCTCTGATGCTCCCCTCCACCACAACCTTCAACGCCGTGGGCGGCATGTTCCTCACCGGC
CTCCTGATCCCCATTGCTTGGTTCACAAACACCTGGAACACGGGCTACCTGCCCATCCTCACGAATCGAGTGCAC
GATCACTTCGGTAAGCTGTACAACATCTCCAACACCCTCGACTCGCGCGGCATGTTCGACGCCGAAAAGTACGCC
GAGTATTCGCGTCCTTACCTCGGGGCCGCCAACGCGTTGGCCTATGGCTGGCACTTTGCCATTTATACGGCCATT
ATAACGCACGTGCTGCTCTATCACAGGTCTCAGATGATGATGGGTTTCAAGAGCATCTTCAAGAGTCTTCGCTGT
GCATTCTATAGGAGGAAGAAGAAGACGGATCGGAGTGCCGGTGACGCCGTTCAGGAGGAGAGATACCCAGACGTC
CACAACCGCCTGATGTCGGTATACGCAGAGATTCCCGAATGGTGGTTCTGCCTCATCCTGGCCATCTCCATCTTA
CTGGGCATCCTCGGAATCGTCCTCTGGCCGACCTACACCTCGCCCGCCGTCGTCCTCTACGGCATCCTTCTATGC
CTTCTCTTCATCGTCCCCATCGGCGTGACGGTTAGCATGACGGGCATGGAGATTACGCTCAACGTGCTAGCCGAG
TTCATTGGAGGCGTCATCGTCGAGGGCAACGCGCTGGCCATGAACTTTTTCAAGTCTTACGGGTACATTACTTGT
GCACACGCCATTTCCTTTCTCCAGGACCTCAAGATAGCTCATTATGTCAAGATCCCTCCCCGGGTCACCTTCATG
GGCCAGATGGTAGCCACGCTGATCTCGACCACTGTCTGCACCGGTGTCTTCATGTTCCAGATGAACATCAAGGAC
GTCTGCACCGCCTCAGCCCCCATGAGGTTCTTCTGCCCCGGTCCCAACACCTTCATGACGGCTTCCGTCCTCTGG
GGCACCATCGGCCCCATAAAGGTATTCGGCAAGGAAGGCTACTACAAGTGGCTCCTGATGGGCTTCCCCGTCGGC
TTCCTCCTCGTCTCCATCGTCTGGGCCCTGCAGAGGCGTTATCCAGACTCGGGCTTCCTTCGACGGATCAACGTC
GTCGTCGCCATCGCCGGTTCGCTACAGTGGGCTCCCTATAGCTTCTCTTACGCGTGGCCGGCGCTGCCCGTCGCC
TGGTACTCGTGGATCTACGTCCGCAGCCGCCATCTCAACTTCTGGTCACGATACAACTACGTTCTCTCGGCCTCG
CTCTCGGCCGGCGTCGCCATCTCCGCCATAATCATGCTCTTCACCGTCCAGTGGGCCGGTATCAATGTCAACTGG
TGGGGGAACTCTCAGCCGTTCAAGGGTTGCGAGGGTGAGCCTTGCCGGCTGTATAAGCTGGCTGAAGGGGAGAGG
TTCTGA
Gene >Ophcf2|01129
ATGCCGACTCGCAAGGTCAGAGTCGACGAAGACCAGGCTACGATGAAAGAGGCAATGGAGAACGGCCGAGGGAGC
AACAAGGGCGACAAAGCCATCATCCTGGAGAAGATGGTGAGTCGTTTTTTTTGTTTTTCCAGTTGGGTGGTTCCG
AACGCGCGGAACAGCTCTGACGGATGCCGTCTTTGTTCCGTAGCCCTCGGACGATGCCGAGACGACTGGTAGCCT
CAAGTCGGGTCTCCCCCCCCCCTTTTTTTTTTTTTTATTTTTTTTTATATTTTGGCCATCTTGAGCGTCCGGCTC
TGGCTGACTTGCTCGCGGGCAGACACCTCGATGCTACCGAGGATGATATTCTCGAGGCTAGGGAGTTGGCGGCCT
CGATGAGCCTGGAGACGGTCCATGGAGTTGGTCTCGATGCCCCTTGAGCTTGGCAGCGTCTTGTATCTGACCTCG
ATGGCTTAGATGATGAAGAAGGTGTTGGCAGACCACGAGAACGATCCCAACTTCAACCACGCCACTGTCGAGGTC
ATCAAGACGTTTCTGTGTACGAGCCTCCTCCATCTCTGTTTTCGAAACCCCCCTTTGCCCCTGACAGTCCCAAAC
CGGCGCAGCCGACCAAGATGTCCTCCTCAACCCGGAGAAGCACGAGCAACTCGTGGAGCGGATCAAGCTCGAAGC
AGCCCTCATCGCGACCAACAGCCCCTACGCCGAGGTCCGAGCCAACGTCGACAACCACGACAAGGCCGACATGCC
CGTCTCGACCATCCGGGCCTGGACGCTGGGCTGCCTCTTCAGCGTGCTCCTCTCCTTCGTCAACCAGCTCTTCTC
GGTCCGGCAGCCGTCCATCAAGTTCGAGACCAACGTCGCCCAGTTGCTATCGTACCCGCTGGGAAAGTGCTGGGA
GAGATGGATGCCCCGTTACGATGTGCCCATCCCCTTTACCGGCCGCAGCGTGAGCCTCAATCCGGGACCGTTTAA
TAAGAAGGAGCATATGCTCATCGCCATCATGGCCAACACGTCCAAGAGCCTTCCGTACACCAACTTCATGATCTG
GACGCAGGTGTTGCCCCAGGGCTTTAACCAGCAGTACGCTCGCAGCGCGGGATACATGTTCCTCAACGCCTTTGC
TACCAATTTCATCGGTTACGGGTTGGCCGGCGTCATGCGTAAGATCCTCGTCAAGCCGGCTTATTGCATCTGGCC
GACCGTCTTCTCGACCATTGCTCTCAACGCGGCACTGCATCCGGGGGCAGGGGATGAGACCAAGACGGTCAGAGG
GCCGATGCGAACGACGTGGACCATGTCTCGTTACCGGTTCTTCCTCTACACCTTCTTCGCCATGCTCGTGTACTT
TTGGTTCCCCAACTATCTGTTTCAGGCCTTGTCGTACTTTTCGTGGATGACGTGGATTGCGCCGGACAACCTGAC
GCTGAACATCTTTACGGGGATGCAGAATGGGCTCGGGGTATGTTTTCGTCGTGTTTCCTCGAGTTGTCTCGGTGG
AGAGTTGATGCTGATATCGGAGACAAGCTGTTCAACCCCTTTCCGACCTTTGACTGGAACTGCATGACCTACATC
ACCGATCCTCTGGTCTGTCCTCTTCCGTTCGACGACTCGGATACCGTCTTCTCACTTACAAACGACAGATGCTCC
CCTCCACCACAACCTTCAACGCCGTGGGCGGCATGTTCCTCACCGGCCTCCTGATCCCCATTGCTTGGTTCACAA
ACACCTGGAACACGGGCTACCTGCCCATCCTCACGAATCGAGTGCACGATCACTTCGGTAAGCTGTACAACATCT
CCAACACCCTCGACTCGCGCGGCATGTTCGACGCCGAAAAGTACGCCGAGTATTCGCGTCCTTACCTCGGGGCCG
CCAACGCGTTGGCCTATGGCTGGCACTTTGCCATTTATACGGCCATTATAACGCACGTGCTGCTCTATCACAGGT
CTCAGATGATGATGGGTTTCAAGAGCATCTTCAAGAGTCTTCGCTGTGCATTCTATAGGAGGAAGAAGAAGACGG
ATCGGAGTGCCGGTGACGCCGTTCAGGAGGAGAGATACCCAGACGTCCACAACCGCCTGATGTCGGTATACGCAG
AGAGTAAGCGTCCTTGTACTGACTGAAAAAAACCGACTTCAACGGGCTCGATACTAACACCAACATGTCATCCAG
TTCCCGAATGGTGGTTCTGCCTCATCCTGGCCATCTCCATCTTACTGGGCATCCTCGGAATCGTCCTCTGGCCGA
CCTACACCTCGCCCGCCGTCGTCCTCTACGGCATCCTTCTATGCCTTCTCTTCATCGTCCCCATCGGCGTGACGG
TTAGCATGACGGGCATGGAGATTACGCTCAACGTGCTAGCCGAGTTCATTGGAGGCGTCATCGTCGAGGGCAACG
CGCTGGCCATGAACTTTTTCAAGTCTTACGGGTACATTACTTGTGCACACGCCATTTCCTTTCTCCAGGACCTCA
AGATAGCTCATTATGTCAAGGTATGTATAGTTAGTTGTCAGAGACAATCGTCATCAGAGCCGAAAGATGGCTGAC
CCGAGCAGATCCCTCCCCGGGTCACCTTCATGGGCCAGATGGTAGCCACGCTGATCTCGACCACTGTCTGCACCG
GTGTCTTCATGTTCCAGGTATGCCGTCTCTCTAGACTATAGAGTTGGGAGAGATCCTAGCTGAGCCCTGTAGATG
AACATCAAGGACGTCTGCACCGCCTCAGCCCCCATGAGGTTCTTCTGCCCCGGTCCCAACACCTTCATGACGGCT
TCCGTCCTCTGGGGCACCATCGGCCCCATAAAGGTATTCGGCAAGGAAGGCTACTACAAGTGGCTCCTGATGGGC
TTCCCCGTCGGCTTCCTCCTCGTCTCCATCGTCTGGGCCCTGCAGAGGCGTTATCCAGACTCGGGCTTCCTTCGA
CGGATCAACGTCGTCGTCGCCATCGCCGGTTCGCTACAGTGGGCTCCCTATAGCTTCTCTTACGCGTGGCCGGCG
CTGCCCGTCGCCTGGTACTCGTGGATCTACGTCCGCAGCCGCCATCTCAACTTCTGGTCACGATACAACTACGTT
CTCTCGGCCTCGCTCTCGGCCGGCGTCGCCATCTCCGCCATAATCATGCTCTTCACCGTCCAGTGGGCCGGTATC
AATGTCAACTGGTGGGGGAACTCTCAGCCGTTCAAGGGTTGCGAGGGTGAGCCTTGCCGGCTGTATAAGCTGGCT
GAAGGGGAGAGGTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail