Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01128
Gene name
Locationscaffold_01:4117919..4122143
Strand+
Gene length (bp)4224
Transcript length (bp)2934
Coding sequence length (bp)2934
Protein length (aa) 978

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01265 Cyto_heme_lyase Cytochrome c/c1 heme lyase 8.3E-119 1 279

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0004408 holocytochrome-c synthase activity Yes
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0016846 carbon-sulfur lyase activity No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0016829 lyase activity No
GO:0043226 organelle No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0140096 catalytic activity, acting on a protein No
GO:0110165 cellular anatomical entity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5856 0.2822 0.159 0.2405 0.4883 0.2627 0.2944 0.3781 0.3785 0.1381

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup480
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3341
Ophiocordyceps australis map64 (Brazil) OphauB2|7016
Ophiocordyceps camponoti-floridani Ophcf2|01128 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7178
Ophiocordyceps camponoti-rufipedis Ophun1|7179
Ophiocordyceps kimflemingae Ophio5|2491
Ophiocordyceps kimflemingae Ophio5|5247
Ophiocordyceps subramaniannii Hirsu2|1062

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01128
MGWFWADAATAAPPKAPRRAPPAVCPVQHDYPGSVKPSRMPPSSCPVPHMSRAEEKPSVLSKLNPLNYMFSDLSQ
KPAPNQRIALPTSREESTIPKGSGDGTWEYPSPQQMYNALLRKGYTDTDVTAVESMVSVHNFLNEGAWAEILGWE
RRFSRGLYRGWQVCKRGEAHTAEELERHWDGNEGNPTLVRFQGRPKDLTPKATMIQVLGWIYPSKFGTELPFDRH
DWYVSREVKGEQKQIRYVIDYYSGEPEPNGDPVFYLDVRPAATPLGATERMIRWGTDVWWRAVGGDTREKDPAKR
KKPTSKGSTSKVQFVDFFYVAAIWGPQDAMTHGLVEDGVAPPPGAYTIDMPGNGDEGRQTVVARQSEAEEIRRYT
FRPNRTADEDKPAYIYRIRATDDEVEFMRQGNFVHLSGHWPSGNIIQYAELPADGTLHAMFSGSTVSDAMPEAIQ
RLADHLPWQTLWRQGATTPPPRDACLQDHTYALREDTIAAAYREVHANRDRENYSPPVQIIIRNYHCGPRPNQTC
ASQVDQAVARAESRLGDVGQQGLQPSQATDLLFGLLEEIGVLPVTGAEDDSDMMDHDGGSSSQGTESRAEPPLPE
EQPRSRVEPPLPEEQPQSRVEHPLPQQQPQSRVEPPLPQQQPQYRVEPPLPDDQSETRIVNLPSTDSHSLGHQGG
AAEHAGQQGAGPSQNHSNRQTNRDEAYDSCPESVIDDFLRDLPNILSPSENVCHAALDVNSSCEDTSPRESVARV
VVEANMASDDGENHAADWASILLQPPSENRALDALLLSTMSGILHSKNLPKREQAGGRSRERTARTRADFCRVFS
SWTEKTCDAASKKPAKAATDSTKCPIGEVKVRFKIADNLLSGTVNTVRVDLNGVWDPVYEVSLPLPRQEYEQVLT
RKQLEKRGIASIASINRMQISNVAGLGFFSVSLDYAAIHVHCADSGVRMKAVKDIYGSIRAGSSWLGDIAAGDWK
AE*
Coding >Ophcf2|01128
ATGGGCTGGTTCTGGGCCGATGCCGCTACTGCCGCTCCTCCCAAGGCCCCTCGGCGAGCGCCTCCCGCCGTCTGT
CCTGTTCAGCATGACTACCCCGGCTCCGTGAAGCCATCTCGGATGCCTCCAAGCAGCTGTCCCGTCCCGCACATG
TCCCGCGCCGAAGAGAAGCCGTCGGTGCTGTCTAAACTGAACCCTCTCAACTACATGTTCTCCGACCTGTCCCAG
AAGCCCGCGCCGAATCAGAGAATTGCGCTCCCAACGTCCCGGGAAGAGTCGACGATACCAAAGGGGTCCGGCGAC
GGAACGTGGGAATATCCATCTCCGCAGCAGATGTACAACGCTCTCCTGCGCAAGGGCTATACCGACACCGACGTC
ACCGCCGTCGAGTCCATGGTCTCGGTCCACAATTTCCTCAACGAAGGCGCCTGGGCCGAGATTCTTGGTTGGGAA
CGGCGCTTCTCCCGTGGACTGTACAGAGGCTGGCAGGTGTGCAAGCGAGGCGAGGCTCACACCGCCGAGGAGCTG
GAACGTCACTGGGATGGCAACGAGGGGAACCCAACCCTCGTGCGGTTCCAGGGAAGGCCTAAGGACTTGACTCCA
AAGGCCACCATGATTCAGGTTCTAGGATGGATCTATCCCTCCAAGTTTGGAACGGAACTACCCTTTGACCGACAC
GACTGGTATGTATCTCGCGAGGTCAAGGGCGAGCAGAAGCAGATCAGGTATGTCATCGACTACTACTCAGGGGAG
CCGGAGCCCAACGGCGACCCTGTCTTTTACCTCGATGTCCGGCCGGCTGCTACGCCACTCGGGGCCACCGAAAGG
ATGATTCGATGGGGCACCGACGTGTGGTGGAGGGCCGTCGGGGGTGACACGAGGGAGAAGGATCCGGCCAAGAGG
AAGAAGCCAACATCCAAGGGATCAACGTCAAAAGTCCAATTCGTGGACTTCTTTTACGTCGCGGCCATCTGGGGG
CCGCAGGATGCGATGACTCACGGGCTCGTTGAGGATGGCGTTGCACCCCCCCCTGGAGCTTATACCATCGATATG
CCCGGCAACGGAGATGAAGGCAGGCAAACGGTGGTGGCTCGCCAGAGCGAGGCGGAGGAGATACGGCGATATACG
TTTCGTCCCAACCGGACAGCAGACGAAGACAAACCAGCCTACATTTACCGCATCCGAGCCACGGATGATGAGGTC
GAGTTCATGAGACAGGGCAACTTTGTTCACCTGAGCGGACACTGGCCATCTGGGAATATAATTCAGTACGCCGAG
CTGCCGGCCGATGGAACGCTTCATGCCATGTTTTCCGGTTCGACCGTGTCGGACGCGATGCCGGAAGCGATTCAA
CGACTCGCTGATCACTTGCCATGGCAGACGTTGTGGCGGCAGGGTGCTACGACTCCTCCGCCTCGCGACGCCTGT
CTTCAAGACCACACGTATGCGTTGCGAGAGGACACCATTGCTGCCGCCTACCGCGAGGTTCACGCCAATAGGGAT
CGAGAAAATTACAGTCCGCCGGTGCAGATTATCATAAGAAACTATCATTGCGGTCCGAGGCCGAACCAGACCTGC
GCTTCTCAGGTTGACCAGGCCGTGGCGAGAGCCGAGTCCAGGCTGGGTGACGTTGGGCAACAAGGCTTGCAGCCG
TCACAGGCGACGGATCTTCTTTTTGGCTTGTTGGAGGAAATAGGCGTACTCCCTGTCACGGGCGCGGAGGATGAT
TCTGACATGATGGATCATGATGGCGGCTCTTCAAGCCAGGGAACCGAGTCTCGGGCTGAGCCTCCTCTTCCTGAG
GAACAGCCTCGGTCTCGGGTCGAGCCTCCTCTTCCTGAGGAACAGCCTCAGTCTCGGGTCGAGCACCCTCTTCCT
CAGCAACAGCCTCAGTCCCGGGTCGAGCCCCCTCTTCCTCAGCAACAGCCTCAGTATCGGGTCGAGCCCCCTCTA
CCTGATGATCAGTCCGAGACTCGGATCGTGAACCTTCCTTCTACTGACTCTCATTCTCTTGGCCACCAAGGCGGT
GCTGCTGAACACGCTGGTCAGCAGGGAGCAGGACCATCACAGAACCACTCGAATAGGCAAACGAACCGGGATGAA
GCGTACGACAGTTGCCCAGAGTCGGTGATAGATGACTTCCTACGAGACCTGCCCAACATCTTGTCGCCGAGCGAG
AATGTCTGCCACGCTGCCCTCGACGTCAACAGCTCCTGCGAAGACACATCGCCAAGAGAGTCTGTTGCCCGGGTC
GTGGTCGAAGCCAATATGGCGTCCGACGACGGCGAGAACCATGCTGCTGATTGGGCTTCGATACTCCTCCAGCCG
CCAAGCGAGAACCGGGCATTAGACGCTTTACTCCTCAGCACGATGAGCGGAATTCTCCATAGCAAAAACCTGCCG
AAGCGAGAGCAGGCCGGTGGGAGAAGCCGTGAGAGAACAGCCAGAACCAGAGCCGATTTCTGCCGAGTATTTTCA
TCCTGGACGGAAAAGACGTGCGACGCGGCGTCCAAGAAGCCTGCCAAAGCAGCAACGGACTCGACGAAATGCCCA
ATAGGCGAGGTCAAAGTCAGGTTCAAGATTGCCGATAACTTGTTGTCCGGGACTGTGAATACCGTCAGGGTGGAC
TTAAACGGCGTCTGGGATCCAGTTTACGAAGTCTCGTTGCCGCTACCACGACAAGAATACGAACAAGTTCTGACA
CGAAAGCAACTGGAGAAACGGGGAATAGCAAGCATCGCCAGCATCAACAGAATGCAGATAAGTAACGTGGCGGGG
CTCGGGTTCTTTTCCGTATCCCTTGACTACGCGGCTATACATGTCCATTGCGCCGACTCTGGCGTCCGGATGAAG
GCCGTCAAGGACATCTACGGGTCAATCAGGGCTGGCAGCTCCTGGTTGGGTGACATTGCTGCGGGAGACTGGAAG
GCCGAGTGA
Transcript >Ophcf2|01128
ATGGGCTGGTTCTGGGCCGATGCCGCTACTGCCGCTCCTCCCAAGGCCCCTCGGCGAGCGCCTCCCGCCGTCTGT
CCTGTTCAGCATGACTACCCCGGCTCCGTGAAGCCATCTCGGATGCCTCCAAGCAGCTGTCCCGTCCCGCACATG
TCCCGCGCCGAAGAGAAGCCGTCGGTGCTGTCTAAACTGAACCCTCTCAACTACATGTTCTCCGACCTGTCCCAG
AAGCCCGCGCCGAATCAGAGAATTGCGCTCCCAACGTCCCGGGAAGAGTCGACGATACCAAAGGGGTCCGGCGAC
GGAACGTGGGAATATCCATCTCCGCAGCAGATGTACAACGCTCTCCTGCGCAAGGGCTATACCGACACCGACGTC
ACCGCCGTCGAGTCCATGGTCTCGGTCCACAATTTCCTCAACGAAGGCGCCTGGGCCGAGATTCTTGGTTGGGAA
CGGCGCTTCTCCCGTGGACTGTACAGAGGCTGGCAGGTGTGCAAGCGAGGCGAGGCTCACACCGCCGAGGAGCTG
GAACGTCACTGGGATGGCAACGAGGGGAACCCAACCCTCGTGCGGTTCCAGGGAAGGCCTAAGGACTTGACTCCA
AAGGCCACCATGATTCAGGTTCTAGGATGGATCTATCCCTCCAAGTTTGGAACGGAACTACCCTTTGACCGACAC
GACTGGTATGTATCTCGCGAGGTCAAGGGCGAGCAGAAGCAGATCAGGTATGTCATCGACTACTACTCAGGGGAG
CCGGAGCCCAACGGCGACCCTGTCTTTTACCTCGATGTCCGGCCGGCTGCTACGCCACTCGGGGCCACCGAAAGG
ATGATTCGATGGGGCACCGACGTGTGGTGGAGGGCCGTCGGGGGTGACACGAGGGAGAAGGATCCGGCCAAGAGG
AAGAAGCCAACATCCAAGGGATCAACGTCAAAAGTCCAATTCGTGGACTTCTTTTACGTCGCGGCCATCTGGGGG
CCGCAGGATGCGATGACTCACGGGCTCGTTGAGGATGGCGTTGCACCCCCCCCTGGAGCTTATACCATCGATATG
CCCGGCAACGGAGATGAAGGCAGGCAAACGGTGGTGGCTCGCCAGAGCGAGGCGGAGGAGATACGGCGATATACG
TTTCGTCCCAACCGGACAGCAGACGAAGACAAACCAGCCTACATTTACCGCATCCGAGCCACGGATGATGAGGTC
GAGTTCATGAGACAGGGCAACTTTGTTCACCTGAGCGGACACTGGCCATCTGGGAATATAATTCAGTACGCCGAG
CTGCCGGCCGATGGAACGCTTCATGCCATGTTTTCCGGTTCGACCGTGTCGGACGCGATGCCGGAAGCGATTCAA
CGACTCGCTGATCACTTGCCATGGCAGACGTTGTGGCGGCAGGGTGCTACGACTCCTCCGCCTCGCGACGCCTGT
CTTCAAGACCACACGTATGCGTTGCGAGAGGACACCATTGCTGCCGCCTACCGCGAGGTTCACGCCAATAGGGAT
CGAGAAAATTACAGTCCGCCGGTGCAGATTATCATAAGAAACTATCATTGCGGTCCGAGGCCGAACCAGACCTGC
GCTTCTCAGGTTGACCAGGCCGTGGCGAGAGCCGAGTCCAGGCTGGGTGACGTTGGGCAACAAGGCTTGCAGCCG
TCACAGGCGACGGATCTTCTTTTTGGCTTGTTGGAGGAAATAGGCGTACTCCCTGTCACGGGCGCGGAGGATGAT
TCTGACATGATGGATCATGATGGCGGCTCTTCAAGCCAGGGAACCGAGTCTCGGGCTGAGCCTCCTCTTCCTGAG
GAACAGCCTCGGTCTCGGGTCGAGCCTCCTCTTCCTGAGGAACAGCCTCAGTCTCGGGTCGAGCACCCTCTTCCT
CAGCAACAGCCTCAGTCCCGGGTCGAGCCCCCTCTTCCTCAGCAACAGCCTCAGTATCGGGTCGAGCCCCCTCTA
CCTGATGATCAGTCCGAGACTCGGATCGTGAACCTTCCTTCTACTGACTCTCATTCTCTTGGCCACCAAGGCGGT
GCTGCTGAACACGCTGGTCAGCAGGGAGCAGGACCATCACAGAACCACTCGAATAGGCAAACGAACCGGGATGAA
GCGTACGACAGTTGCCCAGAGTCGGTGATAGATGACTTCCTACGAGACCTGCCCAACATCTTGTCGCCGAGCGAG
AATGTCTGCCACGCTGCCCTCGACGTCAACAGCTCCTGCGAAGACACATCGCCAAGAGAGTCTGTTGCCCGGGTC
GTGGTCGAAGCCAATATGGCGTCCGACGACGGCGAGAACCATGCTGCTGATTGGGCTTCGATACTCCTCCAGCCG
CCAAGCGAGAACCGGGCATTAGACGCTTTACTCCTCAGCACGATGAGCGGAATTCTCCATAGCAAAAACCTGCCG
AAGCGAGAGCAGGCCGGTGGGAGAAGCCGTGAGAGAACAGCCAGAACCAGAGCCGATTTCTGCCGAGTATTTTCA
TCCTGGACGGAAAAGACGTGCGACGCGGCGTCCAAGAAGCCTGCCAAAGCAGCAACGGACTCGACGAAATGCCCA
ATAGGCGAGGTCAAAGTCAGGTTCAAGATTGCCGATAACTTGTTGTCCGGGACTGTGAATACCGTCAGGGTGGAC
TTAAACGGCGTCTGGGATCCAGTTTACGAAGTCTCGTTGCCGCTACCACGACAAGAATACGAACAAGTTCTGACA
CGAAAGCAACTGGAGAAACGGGGAATAGCAAGCATCGCCAGCATCAACAGAATGCAGATAAGTAACGTGGCGGGG
CTCGGGTTCTTTTCCGTATCCCTTGACTACGCGGCTATACATGTCCATTGCGCCGACTCTGGCGTCCGGATGAAG
GCCGTCAAGGACATCTACGGGTCAATCAGGGCTGGCAGCTCCTGGTTGGGTGACATTGCTGCGGGAGACTGGAAG
GCCGAGTGA
Gene >Ophcf2|01128
ATGGGCTGGTTCTGGGCCGATGCCGCTACTGCCGCTCCTCCCAAGGCCCCTCGGCGAGCGCCTCCCGTCAGACCG
CCAGTCGTCCGCAGGATCACCACGTCTTGTCGCTGACGAGTCTCCCCTAGGCCGTCTGTCCTGTTCAGCATGACT
ACCCCGGCTCCGTGAAGCCATCTCGGATGCCTCCAAGCAGCTGTCCCGTCCCGCACATGTCCCGCGCCGAAGAGA
AGCCGTCGGTGCTGTCTAAACTGAACCCTCTCAACTACATGTTCTCCGACCTGTCCCAGAAGCCCGCGCCGAATC
AGAGAATTGCGCTCCCAACGTCCCGGGAAGAGTCGACGATACCAAAGGGGTCCGGCGACGGAACGTGGGAATATC
CATCTCCGCAGCAGATGTACAACGCTCTCCTGCGCAAGGGCTATACCGACACCGACGTCACCGCCGTCGAGTCCA
TGGTCTCGGTCCACAATTTCCTCAACGAAGGCGCCTGGGCCGAGATTCTTGGTTGGGAACGGCGCTTCTCCCGTG
GACTGTACAGAGGCTGGCAGGTGTGCAAGCGAGGCGAGGCTCACACCGCCGAGGAGCTGGAACGTCACTGGGATG
GCAACGAGGGGAACCCAACCCTCGTGCGGTTCCAGGGAAGGCCTAAGGACTTGACTCCAAAGGCCACCATGATTC
AGGTTCTAGGATGGATCTATCCCTCCAAGTTTGGGTACGACCAGTTCATGGTATCTTTGGCGCGTCAAGCTGACA
ACATCTAGAACGGAACTACCCTTTGACCGACACGACTGGTATGTATCTCGCGAGGTCAAGGGCGAGCAGAAGCAG
ATCAGGTATGTCATCGACTACTACTCAGGGGAGCCGGAGCCCAACGGCGACCCTGTCTTTTACCTCGATGTCCGG
CCGGCTGCTACGCCACTCGGGGCCACCGAAAGGATGATTCGATGGGGCACCGACGTGTGGTGGAGGGCCGTCGGG
GGTGACACGAGGGAGAAGGATCCGGTGCGGTTATTCGGCTTCCAGGGTTGGAGGAGATGAGATGCTGTTCTCCCT
CTGGCCGCCTTTGTTGACGGCTCGTGTTTGAAGTGTACAAGGGCCCCTGATGAATTGTACGATTTGGGAGTTGAC
GGTGGGCAATGGGCATTGGGCATTGGGCATTGGGCCAGTGGTTTGCGCTTGATCCTTGTGTAACATCAGCCCTAC
TCTATGAGCTACCTTTTTACAGATGACTTTACCCGACTTGACTCGGTTCAAGTTTGGAGACTTGCTGCCGAGTAT
CGACGTGAATCTCCTAGATTGTTATCGAACGGAAAATCATGCCGTCGAATCACAACTCTCGGTTACGTATGTACA
AACGGTACAATACGTGAGTTTGCTGGTGGCCCGGCTCGGGTCTTCTATCACGTCAATTGGCCAGCTTCGCCTCGT
GGCTTGGAATAGCCAAGGATTATCAAGGCTATGCTCTTCACGGTTCTTGGCAGCTTCGTCTCGTGGCCTGGAATC
GCCAAGGATAATCACGACTACATATGTATGTTTGCTCTTCACGGTTCTTTGGAGAAAAAAGGGCGATTGAGGTAT
GTATATTGTGGGTGAAACTGAAGGGCTACGATTCGTGCATACATACATACATGATACATACATACGAGGCGTGAT
TCCTAGGTGTCACCTTTTTTGCAGGGTGAACCTTGAAATACGAGAGCACACATGAAAGGTCGGCCGACGCAGCTA
TTTGCAGACAACTCACAAGGATTCATCAAGGAACAGGGAAACAGAAAGGCACTCAAAGTGATGAGAGTTGAGTCG
ATGAACGTAGCTGGTGGCTATATAAACAAAGCCACGCCAACAGCTTTTTATCATTCTCATCTCATCCAGTCTCGG
CGGCTTTATCATTCAGTCACAGCTTCAACATGGCATATCCACGCTGGGCCGTTGCCGTACTCTATCTTTTCATTT
TCGGACTCTTCACAGATGTATGCCAAGGTCAGGCCAAGAGGAAGAAGCCAACATCCAAGGGATCAACGTCAAAAG
TCCAATTCGTGGACTTCTTTTACGTCGCGGCCATCTGGGGGCCGCAGGATGCGATGACTCACGGGCTCGTTGAGG
ATGGCGTTGCACCCCCCCCTGGAGCTTATACCATCGATATGCCCGGCAACGGAGATGAAGGCAGGCAAACGGTGG
TGGCTCGCCAGAGCGAGGCGGAGGAGATACGGCGATATACGTTTCGTCCCAACCGGACAGCAGACGAAGACAAAC
CAGCCTACATTTACCGCATCCGAGCCACGGATGATGAGGTCGAGTTCATGAGACAGGGCAACTTTGTTCACCTGA
GCGGACACTGGCCATCTGGGAATATAATTCAGTACGCCGAGCTGCCGGCCGATGGAACGCTTCATGCCATGTTTT
CCGGTTCGACCGTGTCGGACGCGATGCCGGAAGCGATTCAACGACTCGCTGATCACTTGCCATGGCAGACGTTGT
GGCGGCAGGGTGCTACGACTCCTCCGCCTCGCGGTAAGACGTCGTCCTCTCTTCAGCCGTTGCAGCACTAACATG
AGATTCAAAAGACGCCTGTCTTCAAGACCACACGTATGCGTTGCGAGAGGACACCATTGCTGCCGCCTACCGCGA
GGTTCACGCCAATAGGGATCGAGAAAATTACAGTCCGCCGGTGCAGATTATCATAAGAAACTATCATTGCGGTCC
GAGGCCGAACCAGACCTGCGCTTCTCAGGTTGACCAGGCCGTGGCGAGAGCCGAGTCCAGGCTGGGTGACGTTGG
GCAACAAGGCTTGCAGCCGTCACAGGCGACGGATCTTCTTTTTGGCTTGTTGGAGGAAATAGGCGTACTCCCTGT
CACGGGCGCGGAGGATGATTCTGACATGATGGATCATGATGGCGGCTCTTCAAGCCAGGGAACCGAGTCTCGGGC
TGAGCCTCCTCTTCCTGAGGAACAGCCTCGGTCTCGGGTCGAGCCTCCTCTTCCTGAGGAACAGCCTCAGTCTCG
GGTCGAGCACCCTCTTCCTCAGCAACAGCCTCAGTCCCGGGTCGAGCCCCCTCTTCCTCAGCAACAGCCTCAGTA
TCGGGTCGAGCCCCCTCTACCTGATGATCAGTCCGAGACTCGGATCGTGAACCTTCCTTCTACTGACTCTCATTC
TCTTGGCCACCAAGGCGGTGCTGCTGAACACGCTGGTCAGCAGGGAGCAGGACCATCACAGAACCACTCGAATAG
GCAAACGAACCGGGATGAAGCGTACGACAGTTGCCCAGAGTCGGTGATAGATGACTTCCTACGAGACCTGCCCAA
CATCTTGTCGCCGAGCGAGAATGTCTGCCACGCTGCCCTCGACGTCAACAGCTCCTGCGAAGACACATCGCCAAG
AGAGTCTGGTTAGTGACGATGGAAACCCGCCCGATCATGATGCAGGCTTTCATGCTAACCATCTTTCTTTGGCAG
TTGCCCGGGTCGTGGTCGAAGCCAATATGGCGTCCGACGACGGCGAGAACCATGCTGCTGATTGGGCTTCGATAC
TCCTCCAGCCGCCAAGCGAGAACCGGGCATTAGACGCTTTACTCCTCAGCACGATGAGCGGAATTCTCCATAGCA
AAAACCTGCCGAAGCGAGAGCAGGCCGGTGGGAGAAGCCGTGAGAGAACAGCCAGAACCAGAGCCGATTTCTGCC
GAGTATTTTCATCCTGGACGGAAAAGACGTGCGACGCGGCGTCCAAGAAGCCTGCCAAAGCAGCAACGGACTCGA
CGAAATGCCCAATAGGCGAGGTCAAAGTCAGGTTCAAGATTGCCGATAACTTGTTGTCCGGGACTGTGAATACCG
TCAGGGTGGACTTAAACGGCGTCTGGGATCCAGTTTACGAAGTCTCGTTGCCGCTACCACGACAAGAATACGAAC
AAGTTCTGACACGAAAGCAACTGGAGAAACGGGGAATAGCAAGCATCGCCAGCATCAACAGAATGCAGATAAGTA
ACGTGGCGGGGCTCGGGTTCTTTTCCGTATCCCTTGACTGTATGTCTTCTCCCCCCATCCTATGACTCCCTACAT
GAATGTAACCGAGTGTCGTGTTTCTGACGGGCAATGGTTCAAGACGCGGCTATACATGTCCATTGCGCCGACTCT
GGCGTCCGGATGAAGGCCGTCAAGGACATCTACGGGTCAATCAGGGCTGGCAGCTCCTGGTTGGGTGACATTGCT
GCGGGAGACTGGAAGGCCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail