Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01123
Gene name
Locationscaffold_01:4107900..4109539
Strand-
Gene length (bp)1639
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08164 TRAUB Apoptosis-antagonizing transcription factor, C-terminal 1.1E-26 410 493
PF13339 AATF-Che1 Apoptosis antagonizing transcription factor 1.0E-26 225 344

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0005575 cellular_component No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1619 0.9471 0.0302 0.0093 0.023 0.0036 0.0428 0.0557 0.0121 0.0166

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1280
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7746
Ophiocordyceps australis map64 (Brazil) OphauB2|7008
Ophiocordyceps camponoti-floridani Ophcf2|01123 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7184
Ophiocordyceps kimflemingae Ophio5|8200
Ophiocordyceps subramaniannii Hirsu2|1057

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01123
MTLTTHVKKLAEPDEAIVRDDDVESEVPNSDDASDSADDEEAGTEHYVSVGKSRLRQKEGVSLGRDYRGSRVSRL
ALEEVSEAEHSREHSDNEDAYDDPEMADLAVDEAQAGDSEIDSDEAFVESDSGRFHNFSFRGSSKAEKVKHEATA
ADYMSLDEEEEQGGAALASSDGEVNEDESDVAAEGLNRSQDSGDESDEDSEVSDDDDDFGNKVVPRPEAGSSNTD
RVKGMAIQKQRKVYDGLLNLRIRLQKALIAANSMPTLEEESGSESEPYEAAEEAAVKLLNTMSSLRDNMTSSCHR
TGDKRKRTTLSTSMSSEAIWKCLQEEDLQATDFRRERLDKWSRKVQSVSVTATKGLSQKSQTLVEALEEQLANPE
GRLMKRTRVARSCAPVQAAKKVMENDDIYDDADFYQLLLKELVDQRTVETWTTRSSGVRSVMMTATREAKMGKQV
DRKASKGRKMRFTVHEKLQNLMAPEDRRSWEQAAIDRLFGRLFGRKMALDEESSDEGDEGDQGVEGDSAGLRLFR
SEG*
Coding >Ophcf2|01123
ATGACATTGACAACTCACGTCAAGAAACTCGCCGAGCCTGACGAGGCTATCGTCAGAGATGATGATGTTGAAAGC
GAGGTACCGAATAGCGACGACGCCTCTGACAGTGCCGACGATGAGGAGGCTGGGACGGAGCACTATGTCTCTGTA
GGGAAGAGTCGATTGAGACAGAAGGAGGGAGTTTCTCTGGGTAGAGACTATAGAGGCTCTCGCGTGAGCCGATTG
GCGCTCGAGGAGGTCAGCGAAGCCGAGCACTCGCGAGAGCACAGCGACAATGAGGACGCATATGATGATCCGGAA
ATGGCCGATCTCGCTGTCGACGAAGCTCAAGCCGGCGACTCGGAAATCGACAGTGACGAGGCCTTTGTTGAGTCT
GATTCGGGACGTTTTCACAATTTCTCTTTTCGTGGCAGCTCCAAAGCAGAAAAGGTGAAGCACGAAGCGACCGCG
GCAGACTACATGTCCTTGGATGAGGAAGAAGAGCAGGGCGGAGCGGCGCTGGCTAGTTCAGACGGGGAGGTTAAT
GAGGATGAGAGTGATGTTGCGGCAGAAGGATTGAATCGCTCACAAGACTCCGGAGATGAGTCGGACGAGGACTCT
GAAGTTTCCGATGATGATGACGACTTCGGGAACAAGGTCGTGCCCAGACCAGAAGCTGGGTCCAGCAACACAGAC
AGGGTAAAGGGCATGGCAATCCAAAAGCAGCGGAAAGTTTACGACGGCCTCTTGAACCTGCGTATCCGACTTCAA
AAAGCGCTTATAGCGGCCAATTCAATGCCCACGTTGGAGGAAGAGTCCGGGTCGGAATCAGAGCCCTACGAGGCG
GCCGAGGAGGCAGCTGTCAAGCTCCTCAACACCATGAGCAGCCTAAGAGACAACATGACCAGCTCGTGTCACCGC
ACCGGCGACAAACGGAAACGGACGACGTTGTCGACTTCGATGTCGAGCGAGGCCATCTGGAAATGCCTACAAGAG
GAGGACCTGCAGGCGACCGACTTCCGGAGAGAGCGACTGGACAAGTGGTCGCGCAAGGTGCAGAGCGTCAGCGTT
ACGGCGACCAAAGGCCTGAGCCAAAAAAGCCAGACGCTGGTGGAAGCACTCGAGGAGCAACTGGCCAACCCTGAG
GGCCGGCTCATGAAGCGCACGCGCGTGGCCAGATCGTGTGCGCCGGTGCAGGCAGCTAAGAAGGTGATGGAGAAT
GACGACATCTACGACGACGCCGACTTTTACCAGCTGCTGCTAAAAGAGCTCGTCGACCAGCGAACGGTGGAGACG
TGGACGACGCGAAGCAGCGGAGTGCGCAGCGTCATGATGACGGCGACGAGGGAAGCCAAAATGGGCAAGCAGGTG
GATCGCAAGGCGAGCAAGGGCAGAAAGATGAGGTTCACGGTGCACGAGAAGCTGCAGAACCTGATGGCCCCCGAG
GATCGACGCAGCTGGGAGCAGGCGGCCATCGACAGGCTGTTTGGAAGACTCTTTGGCCGCAAGATGGCGCTGGAC
GAGGAGAGTTCCGACGAAGGGGACGAGGGGGACCAAGGGGTCGAAGGGGACTCGGCTGGGCTGCGTCTGTTTCGT
AGCGAGGGCTAG
Transcript >Ophcf2|01123
ATGACATTGACAACTCACGTCAAGAAACTCGCCGAGCCTGACGAGGCTATCGTCAGAGATGATGATGTTGAAAGC
GAGGTACCGAATAGCGACGACGCCTCTGACAGTGCCGACGATGAGGAGGCTGGGACGGAGCACTATGTCTCTGTA
GGGAAGAGTCGATTGAGACAGAAGGAGGGAGTTTCTCTGGGTAGAGACTATAGAGGCTCTCGCGTGAGCCGATTG
GCGCTCGAGGAGGTCAGCGAAGCCGAGCACTCGCGAGAGCACAGCGACAATGAGGACGCATATGATGATCCGGAA
ATGGCCGATCTCGCTGTCGACGAAGCTCAAGCCGGCGACTCGGAAATCGACAGTGACGAGGCCTTTGTTGAGTCT
GATTCGGGACGTTTTCACAATTTCTCTTTTCGTGGCAGCTCCAAAGCAGAAAAGGTGAAGCACGAAGCGACCGCG
GCAGACTACATGTCCTTGGATGAGGAAGAAGAGCAGGGCGGAGCGGCGCTGGCTAGTTCAGACGGGGAGGTTAAT
GAGGATGAGAGTGATGTTGCGGCAGAAGGATTGAATCGCTCACAAGACTCCGGAGATGAGTCGGACGAGGACTCT
GAAGTTTCCGATGATGATGACGACTTCGGGAACAAGGTCGTGCCCAGACCAGAAGCTGGGTCCAGCAACACAGAC
AGGGTAAAGGGCATGGCAATCCAAAAGCAGCGGAAAGTTTACGACGGCCTCTTGAACCTGCGTATCCGACTTCAA
AAAGCGCTTATAGCGGCCAATTCAATGCCCACGTTGGAGGAAGAGTCCGGGTCGGAATCAGAGCCCTACGAGGCG
GCCGAGGAGGCAGCTGTCAAGCTCCTCAACACCATGAGCAGCCTAAGAGACAACATGACCAGCTCGTGTCACCGC
ACCGGCGACAAACGGAAACGGACGACGTTGTCGACTTCGATGTCGAGCGAGGCCATCTGGAAATGCCTACAAGAG
GAGGACCTGCAGGCGACCGACTTCCGGAGAGAGCGACTGGACAAGTGGTCGCGCAAGGTGCAGAGCGTCAGCGTT
ACGGCGACCAAAGGCCTGAGCCAAAAAAGCCAGACGCTGGTGGAAGCACTCGAGGAGCAACTGGCCAACCCTGAG
GGCCGGCTCATGAAGCGCACGCGCGTGGCCAGATCGTGTGCGCCGGTGCAGGCAGCTAAGAAGGTGATGGAGAAT
GACGACATCTACGACGACGCCGACTTTTACCAGCTGCTGCTAAAAGAGCTCGTCGACCAGCGAACGGTGGAGACG
TGGACGACGCGAAGCAGCGGAGTGCGCAGCGTCATGATGACGGCGACGAGGGAAGCCAAAATGGGCAAGCAGGTG
GATCGCAAGGCGAGCAAGGGCAGAAAGATGAGGTTCACGGTGCACGAGAAGCTGCAGAACCTGATGGCCCCCGAG
GATCGACGCAGCTGGGAGCAGGCGGCCATCGACAGGCTGTTTGGAAGACTCTTTGGCCGCAAGATGGCGCTGGAC
GAGGAGAGTTCCGACGAAGGGGACGAGGGGGACCAAGGGGTCGAAGGGGACTCGGCTGGGCTGCGTCTGTTTCGT
AGCGAGGGCTAG
Gene >Ophcf2|01123
ATGACATTGACAACTCACGTCAAGAAACTCGCCGAGCCTGACGAGGCTATCGTCAGAGGTGTTTAAATATCTTTT
CTCTACGGGCCAACCTGGGCTAATTCGGACGCTAGATGATGATGTTGAAAGCGAGGTACCGAATAGCGACGACGC
CTCTGACAGTGCCGACGATGAGGAGGCTGGGACGGAGCACTATGTCTCTGTAGGGAAGAGTCGATTGAGACAGAA
GGAGGGAGTTTCTCTGGGTAGAGACTATAGAGGCTCTCGCGTGAGCCGATTGGCGCTCGAGGAGGTCAGCGAAGC
CGAGCACTCGCGAGAGCACAGCGACAATGAGGACGCATATGATGATCCGGAAATGGCCGATCTCGCTGTCGACGA
AGCTCAAGCCGGCGACTCGGAAATCGACAGTGACGAGGCCTTTGTTGAGTCTGATTCGGGACGTTTTCACAATTT
CTCTTTTCGTGGCAGCTCCAAAGCAGAAAAGGTGAAGCACGAAGCGACCGCGGCAGACTACATGTCCTTGGATGA
GGAAGAAGAGCAGGGCGGAGCGGCGCTGGCTAGTTCAGACGGGGAGGTTAATGAGGATGAGAGTGATGTTGCGGC
AGAAGGATTGAATCGCTCACAAGACTCCGGAGATGAGTCGGACGAGGACTCTGAAGTTTCCGATGATGATGACGA
CTTCGGGAACAAGGTCGTGCCCAGACCAGAAGCTGGGTCCAGCAACACAGACAGGGTAAAGGGCATGGCAATCCA
AAAGCAGCGGAAAGTTTACGACGGCCTCTTGAACCTGCGTATCCGACTTCAAAAAGCGCTTATAGCGGCCAATTC
AATGCCCACGTTGGAGGAAGAGTCCGGGTCGGAATCAGAGCCCTACGAGGCGGCCGAGGAGGCAGCTGTCAAGCT
CCTCAACACCATGAGCAGCCTAAGAGACAACATGACCAGCTCGTGTCACCGCACCGGCGACAAACGGAAACGGAC
GACGTTGTCGACTTCGATGTCGAGCGAGGCCATCTGGAAATGCCTACAAGAGGAGGACCTGCAGGCGACCGACTT
CCGGAGAGAGCGACTGGACAAGTGGTCGCGCAAGGTGCAGAGCGTCAGCGTTACGGCGACCAAAGGCCTGAGCCA
AAAAAGCCAGACGCTGGTGGAAGCACTCGAGGAGCAACTGGCCAACCCTGAGGGCCGGCTCATGAAGCGCACGCG
CGTGGCCAGATCGTGTGCGCCGGTGCAGGCAGCTAAGAAGGTGATGGAGAATGACGACATCTACGACGACGCCGA
CTTTTACCAGCTGCTGCTAAAAGAGCTCGTCGACCAGCGAACGGTGGAGACGTGGACGACGCGAAGCAGCGGAGT
GCGCAGCGTCATGATGACGGCGACGAGGGAAGCCAAAATGGGCAAGCAGGTGGATCGCAAGGCGAGCAAGGGCAG
AAAGATGAGGTTCACGGTGCACGAGAAGCTGCAGAACCTGATGGCCCCCGAGGATCGACGCAGCTGGGAGCAGGC
GGCCATCGACAGGCTGTTTGGAAGACTCTTTGGCCGCAAGATGGCGCTGGACGAGGAGAGTTCCGACGAAGGGGA
CGAGGGGGACCAAGGGGTCGAAGGGGACTCGGCTGGGCTGCGTCTGTTTCGTAGCGAGGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail