Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01116
Gene name
Locationscaffold_01:4096156..4097173
Strand+
Gene length (bp)1017
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 6.2E-33 6 290

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.591 0.2118 0.5227 0.2261 0.3249 0.3154 0.3117 0.1708 0.3255 0.1123

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH43_26 2.2E-79 10 295

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6268
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01116 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7191
Ophiocordyceps kimflemingae Ophio5|3622
Ophiocordyceps subramaniannii Hirsu2|8003

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01116
MSNKTIADCDTPDPWITSSNNNLFYLTFTLANRVEIWASPQLEDFHDCQKTTIWQPEPNSPWSADIWAPELHRIK
GKWYVYTCGAPPDVGNPGHRTLVLESGKEDPMDASGWTFLGPLKGMPDQWSIDATVFSISGDHLYCCWSGWPPGD
ESDTQQDLFLAKMTSPTQVQGETTICICHASKAWERPDEGARGVAEGPTWVDFAGFRGIVYSAHGSWTSEYKLGL
IALQGDDPLRAKSWSKRAAPLLVSDKSHGGPFGPGHASFLPSPYGDDRIYCVYHGTSEYGQGWDNRKARVLSLGP
EAFASDAEPVCCHCGGCLKFSNTKDRVEQVKNKVKKFL*
Coding >Ophcf2|01116
ATGTCCAACAAAACAATCGCCGACTGCGACACCCCAGACCCCTGGATCACGTCATCCAACAACAACCTCTTCTAC
CTCACCTTCACCCTCGCCAACCGCGTCGAAATCTGGGCCTCCCCCCAACTCGAAGACTTCCACGACTGCCAAAAG
ACGACCATCTGGCAACCCGAGCCCAACTCTCCCTGGTCCGCCGACATCTGGGCTCCCGAACTGCACCGCATCAAG
GGGAAATGGTATGTCTATACCTGCGGTGCGCCCCCCGACGTCGGCAACCCCGGTCATCGGACGCTGGTCCTCGAG
AGCGGAAAGGAGGATCCGATGGACGCCAGCGGCTGGACTTTCCTGGGTCCGCTCAAGGGGATGCCCGATCAGTGG
TCCATCGATGCCACCGTCTTCTCCATCTCGGGCGACCATCTTTACTGCTGCTGGAGCGGCTGGCCACCGGGAGAT
GAGAGCGACACGCAACAAGACCTCTTCCTCGCCAAGATGACCAGCCCGACCCAAGTCCAAGGCGAGACCACAATC
TGCATCTGTCACGCGTCCAAAGCCTGGGAACGTCCCGACGAAGGCGCACGGGGCGTGGCAGAGGGTCCTACCTGG
GTGGACTTCGCCGGCTTCCGCGGCATCGTCTACTCCGCCCACGGAAGCTGGACGAGCGAGTACAAGCTCGGGCTC
ATCGCTCTACAGGGCGACGATCCCCTGCGCGCAAAGTCATGGTCCAAGCGAGCAGCGCCTCTCCTCGTCAGCGAT
AAGAGCCACGGCGGTCCCTTTGGTCCTGGACACGCGAGCTTCCTGCCGAGTCCGTACGGGGACGACCGCATCTAC
TGCGTCTATCACGGCACGTCCGAGTACGGACAGGGCTGGGATAATCGCAAGGCCCGTGTCTTGAGTCTCGGGCCT
GAGGCGTTTGCCTCGGATGCTGAGCCCGTGTGTTGTCATTGTGGGGGGTGCTTGAAGTTTAGCAACACCAAGGAT
AGGGTCGAGCAGGTCAAGAACAAGGTGAAGAAGTTTCTGTGA
Transcript >Ophcf2|01116
ATGTCCAACAAAACAATCGCCGACTGCGACACCCCAGACCCCTGGATCACGTCATCCAACAACAACCTCTTCTAC
CTCACCTTCACCCTCGCCAACCGCGTCGAAATCTGGGCCTCCCCCCAACTCGAAGACTTCCACGACTGCCAAAAG
ACGACCATCTGGCAACCCGAGCCCAACTCTCCCTGGTCCGCCGACATCTGGGCTCCCGAACTGCACCGCATCAAG
GGGAAATGGTATGTCTATACCTGCGGTGCGCCCCCCGACGTCGGCAACCCCGGTCATCGGACGCTGGTCCTCGAG
AGCGGAAAGGAGGATCCGATGGACGCCAGCGGCTGGACTTTCCTGGGTCCGCTCAAGGGGATGCCCGATCAGTGG
TCCATCGATGCCACCGTCTTCTCCATCTCGGGCGACCATCTTTACTGCTGCTGGAGCGGCTGGCCACCGGGAGAT
GAGAGCGACACGCAACAAGACCTCTTCCTCGCCAAGATGACCAGCCCGACCCAAGTCCAAGGCGAGACCACAATC
TGCATCTGTCACGCGTCCAAAGCCTGGGAACGTCCCGACGAAGGCGCACGGGGCGTGGCAGAGGGTCCTACCTGG
GTGGACTTCGCCGGCTTCCGCGGCATCGTCTACTCCGCCCACGGAAGCTGGACGAGCGAGTACAAGCTCGGGCTC
ATCGCTCTACAGGGCGACGATCCCCTGCGCGCAAAGTCATGGTCCAAGCGAGCAGCGCCTCTCCTCGTCAGCGAT
AAGAGCCACGGCGGTCCCTTTGGTCCTGGACACGCGAGCTTCCTGCCGAGTCCGTACGGGGACGACCGCATCTAC
TGCGTCTATCACGGCACGTCCGAGTACGGACAGGGCTGGGATAATCGCAAGGCCCGTGTCTTGAGTCTCGGGCCT
GAGGCGTTTGCCTCGGATGCTGAGCCCGTGTGTTGTCATTGTGGGGGGTGCTTGAAGTTTAGCAACACCAAGGAT
AGGGTCGAGCAGGTCAAGAACAAGGTGAAGAAGTTTCTGTGA
Gene >Ophcf2|01116
ATGTCCAACAAAACAATCGCCGACTGCGACACCCCAGACCCCTGGATCACGTCATCCAACAACAACCTCTTCTAC
CTCACCTTCACCCTCGCCAACCGCGTCGAAATCTGGGCCTCCCCCCAACTCGAAGACTTCCACGACTGCCAAAAG
ACGACCATCTGGCAACCCGAGCCCAACTCTCCCTGGTCCGCCGACATCTGGGCTCCCGAACTGCACCGCATCAAG
GGGAAATGGTATGTCTATACCTGCGGTGCGCCCCCCGACGTCGGCAACCCCGGTCATCGGACGCTGGTCCTCGAG
AGCGGAAAGGAGGATCCGATGGACGCCAGCGGCTGGACTTTCCTGGGTCCGCTCAAGGGGATGCCCGATCAGTGG
TCCATCGATGCCACCGTCTTCTCCATCTCGGGCGACCATCTTTACTGCTGCTGGAGCGGCTGGCCACCGGGAGAT
GAGAGCGACACGCAACAAGACCTCTTCCTCGCCAAGATGACCAGCCCGACCCAAGTCCAAGGCGAGACCACAATC
TGCATCTGTCACGCGTCCAAAGCCTGGGAACGTCCCGACGAAGGCGCACGGGGCGTGGCAGAGGGTCCTACCTGG
GTGGACTTCGCCGGCTTCCGCGGCATCGTCTACTCCGCCCACGGAAGCTGGACGAGCGAGTACAAGCTCGGGCTC
ATCGCTCTACAGGGCGACGATCCCCTGCGCGCAAAGTCATGGTCCAAGCGAGCAGCGCCTCTCCTCGTCAGCGAT
AAGAGCCACGGCGGTCCCTTTGGTCCTGGACACGCGAGCTTCCTGCCGAGTCCGTACGGGGACGACCGCATCTAC
TGCGTCTATCACGGCACGTCCGAGTACGGACAGGGCTGGGATAATCGCAAGGCCCGTGTCTTGAGTCTCGGGCCT
GAGGCGTTTGCCTCGGATGCTGAGCCCGTGTGTTGTCATTGTGGGGGGTGCTTGAAGTTTAGCAACACCAAGGAT
AGGGTCGAGCAGGTCAAGAACAAGGTGAAGAAGTTTCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail