Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01114
Gene name
Locationscaffold_01:4093475..4094135
Strand-
Gene length (bp)660
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09791 Oxidored-like Oxidoreductase-like protein, N-terminal 5.8E-10 122 142

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1331 0.242 0.0477 0.105 0.9312 0.0461 0.0526 0.0242 0.019 0.0729

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2492
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7513
Ophiocordyceps australis map64 (Brazil) OphauB2|6959
Ophiocordyceps camponoti-floridani Ophcf2|01114 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7193
Ophiocordyceps kimflemingae Ophio5|3624
Ophiocordyceps subramaniannii Hirsu2|3604

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01114
MTTRATAHLLLRRLPAPPRRRLVTGLSWPQHCPLGPYYDIILRHPTPYKPEPSNPQPEKTPEPANTTQDRPSAPP
RKKKPGRKSSTSESSPADRARIVFGSRLLGPAEEADSAATKRAQSTTIAGVTVPPRPREPDNCCMSGLGDGEVAK
RGWDEEAFANVPVGIREFMKHEKRLKESRQAGAA*
Coding >Ophcf2|01114
ATGACGACACGAGCGACAGCCCATCTCCTCCTCCGTCGTCTTCCCGCGCCCCCCCGAAGACGGCTCGTCACCGGC
CTCTCCTGGCCACAGCACTGTCCGCTGGGTCCCTACTACGACATCATCCTCCGCCACCCGACGCCGTACAAGCCC
GAGCCAAGCAACCCCCAGCCGGAGAAGACGCCCGAACCAGCCAACACCACCCAAGACCGGCCCTCCGCGCCTCCC
CGAAAGAAGAAGCCCGGTCGCAAGTCGTCGACGTCCGAGTCCTCGCCTGCAGACCGCGCCCGCATCGTCTTCGGT
TCCCGCCTCCTCGGTCCGGCCGAGGAAGCCGACAGCGCGGCCACCAAGCGCGCTCAGTCCACCACGATCGCTGGC
GTTACCGTGCCGCCTCGTCCCCGCGAGCCGGATAACTGCTGTATGAGCGGGCTTGGAGATGGCGAGGTGGCTAAG
CGCGGCTGGGATGAAGAGGCGTTTGCCAACGTGCCTGTCGGCATTCGGGAGTTTATGAAGCATGAGAAACGATTA
AAGGAGAGTCGCCAAGCAGGCGCCGCGTGA
Transcript >Ophcf2|01114
ATGACGACACGAGCGACAGCCCATCTCCTCCTCCGTCGTCTTCCCGCGCCCCCCCGAAGACGGCTCGTCACCGGC
CTCTCCTGGCCACAGCACTGTCCGCTGGGTCCCTACTACGACATCATCCTCCGCCACCCGACGCCGTACAAGCCC
GAGCCAAGCAACCCCCAGCCGGAGAAGACGCCCGAACCAGCCAACACCACCCAAGACCGGCCCTCCGCGCCTCCC
CGAAAGAAGAAGCCCGGTCGCAAGTCGTCGACGTCCGAGTCCTCGCCTGCAGACCGCGCCCGCATCGTCTTCGGT
TCCCGCCTCCTCGGTCCGGCCGAGGAAGCCGACAGCGCGGCCACCAAGCGCGCTCAGTCCACCACGATCGCTGGC
GTTACCGTGCCGCCTCGTCCCCGCGAGCCGGATAACTGCTGTATGAGCGGGCTTGGAGATGGCGAGGTGGCTAAG
CGCGGCTGGGATGAAGAGGCGTTTGCCAACGTGCCTGTCGGCATTCGGGAGTTTATGAAGCATGAGAAACGATTA
AAGGAGAGTCGCCAAGCAGGCGCCGCGTGA
Gene >Ophcf2|01114
ATGACGACACGAGCGACAGCCCATCTCCTCCTCCGTCGTCTTCCCGCGCCCCCCCGAAGACGGCTCGTCACCGGC
CTCTCCTGGCCACAGCACTGTCCGCTGGGTCCCTACTACGACATCATCCTCCGCCACCCGACGCCGTACAAGCCC
GAGCCAAGCAACCCCCAGCCGGAGAAGACGCCCGAACCAGCCAACACCACCCAAGACCGGCCCTCCGCGCCTCCC
CGAAAGAAGAAGCCCGGTCGCAAGTCGTCGACGTCCGAGTCCTCGCCTGCAGACCGCGCCCGCATCGTCTTCGGT
TCCCGCCTCCTCGGTCCGGCCGAGGAAGCCGACAGCGCGGCCACCAAGCGCGCTCAGTCCACCACGATCGCTGGC
GTTACCGTGCCGCCTCGTCCCCGCGAGCCGGATAACTGCTGTATGAGCGGGTGCGTCAACTGCGTGTGGGATCGG
TATCGCGACGATGTGGAGGAGTGGTCTGCCAGGAACAGGGAGGCGCAGATGCGGCTTGCCGGCGCTAACTTGGAC
CTTAGGCTTGGAGATGGCGAGGTGGCTAAGCGCGGCTGGGATGAAGAGGCGTTTGCCAACGTGCCTGTCGGCATT
CGGGAGTTTATGAAGCATGAGAAACGATTAAAGGAGAGTCGCCAAGCAGGCGCCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail