Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01108
Gene name
Locationscaffold_01:4081575..4082532
Strand+
Gene length (bp)957
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 155 177 22
2 192 214 22
3 221 243 22
4 253 275 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 12.57 4.49 20.65
Alive In ants, during behavior modification 13.46 4.92 22.01
Dead In ants, recently dead 13.46 4.91 22.00

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.846613 no
Alive Dead 0.998183 no
Dead Fungus 0.848420 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01108
MDDPNATIRPRRESKKKLRMKKNLSVPENQSLTSSPTFSAASSRSAAGAPTSPNSTMGDFWRLLPVGTNSRRNSS
VAADGQRLRRAPSFMASTSSESAGQLATETPLTPFPPLKAAEPGSSTHRASLASPGQQDQNEVADGLYRYQWSLN
TAMHGAVLFGQCVVTLAVLSGFLYTAIVDKSNVDPKGQEMPWKYAETALGLTLATCIGVLALHETRVLSTVAVLY
LQALILAMTMMTSLALWIWIFTHSTSRIVTGAVVSGVAMLMGTAMLAFFRAALVWWIIEEGGELGGSGEEVFED*
Coding >Ophcf2|01108
ATGGACGACCCCAACGCAACGATTCGTCCCCGGCGAGAGAGTAAGAAGAAGCTGCGAATGAAGAAGAATCTCTCC
GTGCCCGAGAATCAGTCGTTGACCTCGTCTCCTACTTTCTCAGCCGCTTCCTCGCGATCGGCTGCTGGTGCGCCC
ACGTCTCCCAATTCCACCATGGGTGACTTCTGGCGTCTCCTCCCCGTTGGCACCAACTCGCGTCGGAATTCGAGC
GTGGCGGCGGATGGCCAGCGCCTCAGACGAGCCCCCAGCTTCATGGCTTCCACGTCGTCCGAGTCGGCTGGACAG
CTGGCTACCGAGACGCCGCTCACGCCTTTCCCGCCTCTGAAGGCTGCTGAGCCGGGCTCATCGACGCACCGTGCT
TCGCTGGCTTCGCCTGGGCAGCAGGATCAGAACGAGGTTGCCGATGGATTGTACCGCTATCAATGGAGCCTCAAC
ACGGCCATGCATGGCGCCGTCTTGTTTGGGCAGTGTGTCGTCACGTTGGCTGTCCTGAGCGGCTTTCTCTACACT
GCCATCGTCGACAAGAGCAACGTGGACCCCAAGGGTCAGGAAATGCCATGGAAATACGCAGAGACGGCTCTCGGC
CTCACCCTCGCTACCTGCATCGGCGTCCTCGCCCTCCACGAGACGCGCGTGCTGTCGACGGTGGCAGTGCTCTAC
CTACAGGCGCTGATCCTCGCCATGACCATGATGACCTCGCTCGCCTTGTGGATCTGGATCTTCACGCACAGCACC
AGCCGCATCGTCACGGGAGCAGTCGTCAGCGGCGTGGCCATGCTCATGGGCACCGCCATGTTGGCCTTTTTCAGG
GCTGCTTTGGTCTGGTGGATTATCGAGGAAGGCGGCGAGCTGGGCGGCAGCGGCGAGGAGGTTTTCGAGGACTAG
Transcript >Ophcf2|01108
ATGGACGACCCCAACGCAACGATTCGTCCCCGGCGAGAGAGTAAGAAGAAGCTGCGAATGAAGAAGAATCTCTCC
GTGCCCGAGAATCAGTCGTTGACCTCGTCTCCTACTTTCTCAGCCGCTTCCTCGCGATCGGCTGCTGGTGCGCCC
ACGTCTCCCAATTCCACCATGGGTGACTTCTGGCGTCTCCTCCCCGTTGGCACCAACTCGCGTCGGAATTCGAGC
GTGGCGGCGGATGGCCAGCGCCTCAGACGAGCCCCCAGCTTCATGGCTTCCACGTCGTCCGAGTCGGCTGGACAG
CTGGCTACCGAGACGCCGCTCACGCCTTTCCCGCCTCTGAAGGCTGCTGAGCCGGGCTCATCGACGCACCGTGCT
TCGCTGGCTTCGCCTGGGCAGCAGGATCAGAACGAGGTTGCCGATGGATTGTACCGCTATCAATGGAGCCTCAAC
ACGGCCATGCATGGCGCCGTCTTGTTTGGGCAGTGTGTCGTCACGTTGGCTGTCCTGAGCGGCTTTCTCTACACT
GCCATCGTCGACAAGAGCAACGTGGACCCCAAGGGTCAGGAAATGCCATGGAAATACGCAGAGACGGCTCTCGGC
CTCACCCTCGCTACCTGCATCGGCGTCCTCGCCCTCCACGAGACGCGCGTGCTGTCGACGGTGGCAGTGCTCTAC
CTACAGGCGCTGATCCTCGCCATGACCATGATGACCTCGCTCGCCTTGTGGATCTGGATCTTCACGCACAGCACC
AGCCGCATCGTCACGGGAGCAGTCGTCAGCGGCGTGGCCATGCTCATGGGCACCGCCATGTTGGCCTTTTTCAGG
GCTGCTTTGGTCTGGTGGATTATCGAGGAAGGCGGCGAGCTGGGCGGCAGCGGCGAGGAGGTTTTCGAGGACTAG
Gene >Ophcf2|01108
ATGGACGACCCCAACGCAACGATTCGTCCCCGGCGAGAGAGTAAGAAGAAGCTGCGAATGAAGAAGAATCTCTCC
GTGCCCGAGAATCAGTCGTTGACCTCGTCTCCTACTTTCTCAGCCGCTTCCTCGCGATCGGCTGCTGGTGCGCCC
ACGTCTCCCAATTCCACCATGGGTGACTTCTGGCGTCTCCTCCCCGTTGGCACCAACTCGCGTCGGAATTCGAGC
GTGGCGGCGGATGGCCAGCGCCTCAGACGAGCCCCCAGCTTCATGGCTTCCACGTCGTCCGAGTCGGCTGGACAG
CTGGCTACCGAGACGCCGCTCACGCCTTTCCCGCCTCTGAAGGCTGCTGAGCCGGGCTCATCGACGCACCGTGCT
TCGCTGGCTTCGCCTGGGCAGCAGGATCAGAACGAGGTTGCCGATGGATTGTACCGCTATCAATGGAGCCTCAAC
ACGGCCATGCATGGCGCCGTCTTGTTTGGGCAGTGTGTCGTCACGTTGGCTGTCCTGAGCGGCTTTCTCTACACT
GCCATCGTCGACAAGAGCAACGTGGACCCCAAGGGTCAGGAAATGTGCGTGACCATCTTCCACCCCCCTTCCCAT
CATCTCAATGCTGACCGATCTTGCAGGCCATGGAAATACGCAGAGACGGCTCTCGGCCTCACCCTCGCTACCTGC
ATCGGCGTCCTCGCCCTCCACGAGACGCGCGTGCTGTCGACGGTGGCAGTGCTCTACCTACAGGCGCTGATCCTC
GCCATGACCATGATGACCTCGCTCGCCTTGTGGATCTGGATCTTCACGCACAGCACCAGCCGCATCGTCACGGGA
GCAGTCGTCAGCGGCGTGGCCATGCTCATGGGCACCGCCATGTTGGCCTTTTTCAGGGCTGCTTTGGTCTGGTGG
ATTATCGAGGAAGGCGGCGAGCTGGGCGGCAGCGGCGAGGAGGTTTTCGAGGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail