Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01097
Gene name
Locationscaffold_01:4055570..4057743
Strand+
Gene length (bp)2173
Transcript length (bp)1989
Coding sequence length (bp)1989
Protein length (aa) 663

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09825 BPL_N Biotin-protein ligase, N terminal 2.0E-109 7 282
PF03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family 1.2E-21 397 539

GO

GO Term Description Terminal node
GO:0036211 protein modification process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0043412 macromolecule modification No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5871 0.6569 0.0715 0.0199 0.1706 0.0089 0.109 0.2402 0.2949 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3359
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7535
Ophiocordyceps australis map64 (Brazil) OphauB2|6975
Ophiocordyceps camponoti-floridani Ophcf2|01097 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|251
Ophiocordyceps kimflemingae Ophio5|6851
Ophiocordyceps subramaniannii Hirsu2|6248

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01097
MAPRRLNVLVFAGTGTTSESVHHCMYSLRRLLSSNYAVTPVGDAALLREPWSATCALLVFPGGADLGYCSVFNGA
GNSRIYEYVRHGGAFLGLCAGGYYGSTRCEFEVGNPPLDVVGFRELAFFPGACRGAAFSGFRYGSERGARAARLE
VNTALLDAPDMFLSYYNGGGVFVDAATASVYVDVLASYADELDVDGGNGSAAVVLCRVGDGKVVLCGPHPEFAAE
NLRPQPDIPWYADLISQLAADNEARVSFLRACLAKLGLDVAQQQTSVPPLSHLHLSSNDGAKVTDILCAWDDILD
KAEGCEVIRGDADTFFVRSHQDSFNLDSLRPSSREAPIADDGQVDFTVIPKSIMAYERGLPSLESTPRFDHELFY
NSLARFQMVEPDATDWGSILLYGEVVTSTNSLLEKNSKMTSRLPTGFTFSASTQLAGRGRGRNAWIAPPGALMFS
VIINHPAHLAVSRPFIFLQYIAVIAVVEAVQSLGAGYQDLPVKLKWPNDIYALDPTPASSRQYVKIGGVLSHCGY
CDGQYQVILGIGINATNPRPTTALTDLLPAGAAPLRIEVLLARILTRLEAVHAQFMRHGFSEDMERRYYRHWLHT
GQAISLEAEGGIRARVLGITRDWGMLRAEETDADGRGTGKIWTLRSDENSFDFWKGLIRRKL*
Coding >Ophcf2|01097
ATGGCGCCCCGGCGTCTCAATGTGCTCGTATTCGCGGGCACCGGCACCACCTCCGAATCGGTGCACCATTGCATG
TACTCGCTGCGCCGGCTGCTATCGTCCAACTACGCCGTGACGCCCGTCGGTGATGCGGCGCTACTCCGGGAGCCG
TGGTCGGCGACGTGCGCGCTGCTCGTCTTCCCCGGCGGTGCGGATCTCGGCTACTGCAGCGTCTTCAACGGAGCT
GGCAATAGTCGGATCTATGAATACGTCCGGCACGGTGGTGCCTTTCTCGGCCTCTGCGCCGGCGGCTACTACGGA
AGTACTCGCTGCGAGTTCGAGGTCGGAAACCCACCTCTTGATGTCGTCGGCTTTCGCGAGCTGGCCTTCTTCCCT
GGTGCCTGTCGCGGAGCTGCCTTCTCGGGCTTCCGGTATGGGAGCGAAAGGGGCGCACGGGCGGCCAGGTTAGAG
GTCAATACTGCTCTTTTGGACGCGCCCGACATGTTCTTGTCATACTACAACGGCGGCGGCGTCTTTGTCGATGCC
GCTACCGCCAGTGTTTATGTCGACGTCTTGGCCTCATACGCCGATGAGCTCGACGTCGATGGTGGCAATGGAAGC
GCCGCTGTTGTCCTCTGCCGTGTCGGGGACGGCAAAGTTGTTCTCTGCGGGCCGCATCCCGAGTTCGCCGCCGAA
AATCTGCGTCCACAGCCCGATATACCCTGGTATGCCGACCTCATCAGCCAGCTTGCCGCCGATAATGAGGCTCGC
GTATCCTTTCTGAGGGCCTGTCTCGCCAAGCTCGGTCTCGACGTGGCTCAACAGCAGACGTCTGTACCTCCACTA
TCCCACCTGCACCTCTCGTCCAACGACGGTGCCAAGGTGACGGACATACTATGCGCCTGGGATGACATCTTGGAC
AAGGCCGAAGGCTGCGAGGTCATCAGGGGCGATGCGGACACCTTCTTCGTCCGCAGCCACCAAGACAGCTTCAAC
CTCGACAGCCTCCGTCCATCTTCGCGGGAGGCGCCCATCGCAGACGACGGCCAGGTCGACTTTACTGTTATTCCC
AAGTCCATCATGGCCTACGAGCGGGGGCTTCCGAGTCTCGAGTCGACGCCGCGCTTCGATCACGAGCTCTTCTAC
AACAGCCTGGCGCGCTTCCAGATGGTCGAGCCCGACGCCACCGACTGGGGCAGCATTCTGCTGTATGGCGAGGTG
GTGACGAGCACCAACTCCCTGCTGGAAAAGAACAGCAAGATGACATCGAGACTGCCCACGGGCTTTACCTTTTCC
GCGTCCACGCAGCTGGCAGGCCGTGGTCGAGGCAGGAATGCTTGGATCGCACCCCCTGGGGCTCTCATGTTCTCG
GTCATCATCAACCATCCGGCACACCTCGCTGTCTCACGCCCGTTCATCTTCCTGCAGTACATTGCCGTCATCGCC
GTTGTCGAGGCCGTCCAGTCGCTGGGCGCCGGCTACCAGGACCTGCCTGTCAAGCTCAAGTGGCCCAATGACATC
TACGCCCTCGATCCGACGCCGGCTTCTTCACGCCAGTACGTCAAGATCGGAGGCGTCCTCTCCCACTGCGGTTAC
TGTGACGGCCAATACCAAGTCATCCTCGGCATCGGCATCAACGCAACCAACCCGCGTCCGACGACGGCCCTCACC
GATCTTTTGCCCGCCGGCGCCGCGCCCCTGAGGATTGAGGTGCTTCTCGCTCGCATCCTCACCCGGCTGGAGGCC
GTCCATGCCCAGTTTATGCGACACGGCTTCTCCGAGGATATGGAGAGACGCTATTATCGCCACTGGCTACACACG
GGTCAGGCCATCTCCCTCGAGGCCGAGGGCGGAATCCGCGCGCGCGTGCTCGGCATCACCAGGGACTGGGGCATG
CTGCGCGCCGAAGAGACGGACGCCGACGGAAGGGGGACGGGCAAGATCTGGACCCTTCGGAGCGACGAGAATAGC
TTCGACTTTTGGAAAGGCCTGATTCGGCGGAAGCTCTAG
Transcript >Ophcf2|01097
ATGGCGCCCCGGCGTCTCAATGTGCTCGTATTCGCGGGCACCGGCACCACCTCCGAATCGGTGCACCATTGCATG
TACTCGCTGCGCCGGCTGCTATCGTCCAACTACGCCGTGACGCCCGTCGGTGATGCGGCGCTACTCCGGGAGCCG
TGGTCGGCGACGTGCGCGCTGCTCGTCTTCCCCGGCGGTGCGGATCTCGGCTACTGCAGCGTCTTCAACGGAGCT
GGCAATAGTCGGATCTATGAATACGTCCGGCACGGTGGTGCCTTTCTCGGCCTCTGCGCCGGCGGCTACTACGGA
AGTACTCGCTGCGAGTTCGAGGTCGGAAACCCACCTCTTGATGTCGTCGGCTTTCGCGAGCTGGCCTTCTTCCCT
GGTGCCTGTCGCGGAGCTGCCTTCTCGGGCTTCCGGTATGGGAGCGAAAGGGGCGCACGGGCGGCCAGGTTAGAG
GTCAATACTGCTCTTTTGGACGCGCCCGACATGTTCTTGTCATACTACAACGGCGGCGGCGTCTTTGTCGATGCC
GCTACCGCCAGTGTTTATGTCGACGTCTTGGCCTCATACGCCGATGAGCTCGACGTCGATGGTGGCAATGGAAGC
GCCGCTGTTGTCCTCTGCCGTGTCGGGGACGGCAAAGTTGTTCTCTGCGGGCCGCATCCCGAGTTCGCCGCCGAA
AATCTGCGTCCACAGCCCGATATACCCTGGTATGCCGACCTCATCAGCCAGCTTGCCGCCGATAATGAGGCTCGC
GTATCCTTTCTGAGGGCCTGTCTCGCCAAGCTCGGTCTCGACGTGGCTCAACAGCAGACGTCTGTACCTCCACTA
TCCCACCTGCACCTCTCGTCCAACGACGGTGCCAAGGTGACGGACATACTATGCGCCTGGGATGACATCTTGGAC
AAGGCCGAAGGCTGCGAGGTCATCAGGGGCGATGCGGACACCTTCTTCGTCCGCAGCCACCAAGACAGCTTCAAC
CTCGACAGCCTCCGTCCATCTTCGCGGGAGGCGCCCATCGCAGACGACGGCCAGGTCGACTTTACTGTTATTCCC
AAGTCCATCATGGCCTACGAGCGGGGGCTTCCGAGTCTCGAGTCGACGCCGCGCTTCGATCACGAGCTCTTCTAC
AACAGCCTGGCGCGCTTCCAGATGGTCGAGCCCGACGCCACCGACTGGGGCAGCATTCTGCTGTATGGCGAGGTG
GTGACGAGCACCAACTCCCTGCTGGAAAAGAACAGCAAGATGACATCGAGACTGCCCACGGGCTTTACCTTTTCC
GCGTCCACGCAGCTGGCAGGCCGTGGTCGAGGCAGGAATGCTTGGATCGCACCCCCTGGGGCTCTCATGTTCTCG
GTCATCATCAACCATCCGGCACACCTCGCTGTCTCACGCCCGTTCATCTTCCTGCAGTACATTGCCGTCATCGCC
GTTGTCGAGGCCGTCCAGTCGCTGGGCGCCGGCTACCAGGACCTGCCTGTCAAGCTCAAGTGGCCCAATGACATC
TACGCCCTCGATCCGACGCCGGCTTCTTCACGCCAGTACGTCAAGATCGGAGGCGTCCTCTCCCACTGCGGTTAC
TGTGACGGCCAATACCAAGTCATCCTCGGCATCGGCATCAACGCAACCAACCCGCGTCCGACGACGGCCCTCACC
GATCTTTTGCCCGCCGGCGCCGCGCCCCTGAGGATTGAGGTGCTTCTCGCTCGCATCCTCACCCGGCTGGAGGCC
GTCCATGCCCAGTTTATGCGACACGGCTTCTCCGAGGATATGGAGAGACGCTATTATCGCCACTGGCTACACACG
GGTCAGGCCATCTCCCTCGAGGCCGAGGGCGGAATCCGCGCGCGCGTGCTCGGCATCACCAGGGACTGGGGCATG
CTGCGCGCCGAAGAGACGGACGCCGACGGAAGGGGGACGGGCAAGATCTGGACCCTTCGGAGCGACGAGAATAGC
TTCGACTTTTGGAAAGGCCTGATTCGGCGGAAGCTCTAG
Gene >Ophcf2|01097
ATGGCGCCCCGGCGTCTCAATGTGCTCGTATTCGCGGGCAAGTTTCTCCCTTCGCAACCGCCTCGGCCCGGCTCA
TCTGACGGTATAGACTGATAGGCACCGGCACCACCTCCGAATCGGTGCACCATTGCATGTACTCGCTGCGCCGGC
TGCTATCGTCCAACTACGCCGTGACGCCCGTCGGTGATGCGGCGCTACTCCGGGAGCCGTGGTCGGCGACGTGCG
CGCTGCTCGTCTTCCCCGGCGGTGCGGATCTCGGCTACTGCAGCGTCTTCAACGGAGCTGGCAATAGTCGGATCT
ATGAATACGTCCGGCACGGTGGTGCCTTTCTCGGCCTCTGCGCCGGCGGCTACTACGGAAGTACTCGCTGCGAGT
TCGAGGTCGGAAACCCACCTCTTGATGTCGTCGGCTTTCGCGAGCTGGCCTTCTTCCCTGGTGCCTGTCGCGGAG
CTGCCTTCTCGGGCTTCCGGTATGGGAGCGAAAGGGGCGCACGGGCGGCCAGGTTAGAGGTCAATACTGCTCTTT
TGGACGCGCCCGACATGTTCTTGTCATACTACAACGGCGGCGGCGTCTTTGTCGATGCCGCTACCGCCAGTGTTT
ATGTCGACGTCTTGGCCTCATACGCCGATGAGCTCGACGTCGATGGTGGCAATGGAAGCGCCGCTGTTGTCCTCT
GCCGTGTCGGGGACGGCAAAGTTGTTCTCTGCGGGCCGCATCCCGAGTGAGTATCGCCTCTCTGCCTGCTCTGAT
GCCTCCTTATCCCCTGGGACCTTCTGATGCCCACCAGGTTCGCCGCCGAAAATCTGCGTCCACAGCCCGATATAC
CCTGGTATGCCGACCTCATCAGCCAGCTTGCCGCCGATAATGAGGCTCGCGTATCCTTTCTGAGGGCCTGTCTCG
CCAAGCTCGGTCTCGACGTGGCTCAACAGCAGACGTCTGTACCTCCACTATCCCACCTGCACCTCTCGTCCAACG
ACGGTGCCAAGGTGACGGACATACTATGCGCCTGGGATGACATCTTGGACAAGGCCGAAGGCTGCGAGGTCATCA
GGGGCGATGCGGACACCTTCTTCGTCCGCAGCCACCAAGACAGCTTCAACCTCGACAGCCTCCGTCCATCTTCGC
GGGAGGCGCCCATCGCAGACGACGGCCAGGTCGACTTTACTGTTATTCCCAAGTCCATCATGGCCTACGAGCGGG
GGCTTCCGAGTCTCGAGTCGACGCCGCGCTTCGATCACGAGCTCTTCTACAACAGCCTGGCGCGCTTCCAGATGG
TCGAGCCCGACGCCACCGACTGGGGCAGCATTCTGCTGTATGGCGAGGTGGTGACGAGCACCAACTCCCTGCTGG
AAAAGTGCGCGCCTCTCTGCCCTGTTTCTTTTGTCTAGGGCCAAACTGACTTCTATGTACTAGGAACAGCAAGAT
GACATCGAGACTGCCCACGGGCTTTACCTTTTCCGCGTCCACGCAGCTGGCAGGCCGTGGTCGAGGCAGGAATGC
TTGGATCGCACCCCCTGGGGCTCTCATGTTCTCGGTCATCATCAACCATCCGGCACACCTCGCTGTCTCACGCCC
GTTCATCTTCCTGCAGTACATTGCCGTCATCGCCGTTGTCGAGGCCGTCCAGTCGCTGGGCGCCGGCTACCAGGA
CCTGCCTGTCAAGCTCAAGTGGCCCAATGACATCTACGCCCTCGATCCGACGCCGGCTTCTTCACGCCAGTACGT
CAAGATCGGAGGCGTCCTCTCCCACTGCGGTTACTGTGACGGCCAATACCAAGTCATCCTCGGCATCGGCATCAA
CGCAACCAACCCGCGTCCGACGACGGCCCTCACCGATCTTTTGCCCGCCGGCGCCGCGCCCCTGAGGATTGAGGT
GCTTCTCGCTCGCATCCTCACCCGGCTGGAGGCCGTCCATGCCCAGTTTATGCGACACGGCTTCTCCGAGGATAT
GGAGAGACGCTATTATCGCCACTGGCTACACACGGGTCAGGCCATCTCCCTCGAGGCCGAGGGCGGAATCCGCGC
GCGCGTGCTCGGCATCACCAGGGACTGGGGCATGCTGCGCGCCGAAGAGACGGACGCCGACGGAAGGGGGACGGG
CAAGATCTGGACCCTTCGGAGCGACGAGAATAGCTTCGACTTTTGGAAAGGCCTGATTCGGCGGAAGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail