Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01094
Gene name
Locationscaffold_01:4052466..4053596
Strand+
Gene length (bp)1130
Transcript length (bp)999
Coding sequence length (bp)999
Protein length (aa) 333

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03134 TB2_DP1_HVA22 TB2/DP1, HVA22 family 6.3E-24 18 94

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.188 0.1433 0.1667 0.1082 0.3547 0.0264 0.7848 0.1408 0.344 0.3289

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 4 26 22
2 39 61 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2801
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7538
Ophiocordyceps australis map64 (Brazil) OphauB2|6978
Ophiocordyceps camponoti-floridani Ophcf2|01094 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|249
Ophiocordyceps kimflemingae Ophio5|6854
Ophiocordyceps subramaniannii Hirsu2|4491

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01094
MFDLFAMFLSSITSFLLPIFASYKALKTSDPAQLTAWLMYWVVFNCCLLAESWVSFILVWIPFYGYIRFFFFLYL
ILPQTQGARTLYEEKIHPFLEENEGSIDKLIATTHQRLRAAGSSYLLKAIDYLKTKILGLPRSEPPPPPPPAGPS
GYTQSLLARFSVPTARLPAAAYSGNDFYNMLAGAVSAAAGGGSRAAGNDSAPLIPPDLRGSAEKMTFIAAQRERL
NVLLSALDREAQELQRADAEQYTSRDDTRDDTRDDTRSRSRSSGAGLSKSRSETDFEKVEAESGDEDGADGSLRR
RQVPGGGAAGSSWIPWGWTAGAGATKSSSREG*
Coding >Ophcf2|01094
ATGTTCGACCTCTTCGCCATGTTCCTCTCCTCCATCACCTCCTTTCTCCTTCCCATCTTCGCCTCCTACAAGGCC
CTCAAGACGTCCGACCCGGCCCAGCTGACGGCCTGGCTCATGTACTGGGTCGTATTCAACTGCTGCCTCCTCGCT
GAATCATGGGTGTCCTTTATCCTCGTCTGGATCCCGTTCTACGGCTACATTCGATTCTTCTTCTTCCTCTACCTG
ATTCTGCCCCAGACACAAGGCGCGCGCACTCTCTACGAAGAAAAGATCCACCCCTTCCTCGAGGAGAACGAGGGC
TCCATCGATAAACTCATCGCAACCACACACCAGCGCCTCCGCGCCGCCGGCTCGTCCTACCTGCTAAAGGCTATA
GACTATCTCAAGACAAAAATCCTCGGCCTTCCTCGCTCCGAGCCGCCTCCTCCTCCGCCACCCGCTGGCCCCTCC
GGCTACACCCAGTCGCTCCTCGCCCGCTTTAGCGTTCCCACGGCGAGGCTGCCGGCCGCCGCGTACTCCGGCAAC
GACTTCTACAACATGCTCGCCGGCGCCGTCTCCGCTGCCGCCGGCGGAGGTAGCCGCGCCGCTGGAAACGACTCG
GCCCCCCTCATCCCGCCCGATCTGCGCGGCTCGGCCGAGAAGATGACCTTCATCGCCGCTCAGCGCGAACGGCTC
AATGTGCTCCTCTCGGCCCTCGACCGTGAGGCTCAGGAGCTTCAGAGAGCCGACGCTGAACAATACACATCCCGC
GACGATACCCGCGACGATACCCGCGACGATACCCGCTCGCGCTCGCGTTCCAGCGGCGCCGGCCTGAGCAAGAGC
CGCAGCGAGACCGACTTCGAAAAGGTTGAGGCCGAGAGCGGCGACGAGGACGGCGCCGACGGGAGCCTTCGCAGG
CGTCAGGTTCCCGGTGGCGGCGCGGCAGGCAGTTCGTGGATACCTTGGGGATGGACAGCCGGTGCAGGCGCGACA
AAGAGCTCTTCACGCGAGGGATAG
Transcript >Ophcf2|01094
ATGTTCGACCTCTTCGCCATGTTCCTCTCCTCCATCACCTCCTTTCTCCTTCCCATCTTCGCCTCCTACAAGGCC
CTCAAGACGTCCGACCCGGCCCAGCTGACGGCCTGGCTCATGTACTGGGTCGTATTCAACTGCTGCCTCCTCGCT
GAATCATGGGTGTCCTTTATCCTCGTCTGGATCCCGTTCTACGGCTACATTCGATTCTTCTTCTTCCTCTACCTG
ATTCTGCCCCAGACACAAGGCGCGCGCACTCTCTACGAAGAAAAGATCCACCCCTTCCTCGAGGAGAACGAGGGC
TCCATCGATAAACTCATCGCAACCACACACCAGCGCCTCCGCGCCGCCGGCTCGTCCTACCTGCTAAAGGCTATA
GACTATCTCAAGACAAAAATCCTCGGCCTTCCTCGCTCCGAGCCGCCTCCTCCTCCGCCACCCGCTGGCCCCTCC
GGCTACACCCAGTCGCTCCTCGCCCGCTTTAGCGTTCCCACGGCGAGGCTGCCGGCCGCCGCGTACTCCGGCAAC
GACTTCTACAACATGCTCGCCGGCGCCGTCTCCGCTGCCGCCGGCGGAGGTAGCCGCGCCGCTGGAAACGACTCG
GCCCCCCTCATCCCGCCCGATCTGCGCGGCTCGGCCGAGAAGATGACCTTCATCGCCGCTCAGCGCGAACGGCTC
AATGTGCTCCTCTCGGCCCTCGACCGTGAGGCTCAGGAGCTTCAGAGAGCCGACGCTGAACAATACACATCCCGC
GACGATACCCGCGACGATACCCGCGACGATACCCGCTCGCGCTCGCGTTCCAGCGGCGCCGGCCTGAGCAAGAGC
CGCAGCGAGACCGACTTCGAAAAGGTTGAGGCCGAGAGCGGCGACGAGGACGGCGCCGACGGGAGCCTTCGCAGG
CGTCAGGTTCCCGGTGGCGGCGCGGCAGGCAGTTCGTGGATACCTTGGGGATGGACAGCCGGTGCAGGCGCGACA
AAGAGCTCTTCACGCGAGGGATAG
Gene >Ophcf2|01094
ATGTTCGACCTCTTCGCCATGTTCCTCTCGTGCGCACGCCCACGATGAAAACTCGCTCGACGCCCGCTGACTCTC
ACGCTCTACAGCTCCATCACCTCCTTTCTCCTTCCCATCTTCGCCTCCTACAAGGCCCTCAAGACGTCCGACCCG
GCCCAGCTGACGGCCTGGCTCATGTACTGGGTCGTATTCAACTGCTGCCTCCTCGCTGAATCATGGGTGTCCTTT
ATCCTCGTCTGGTGCGTCGAAAGAACCGCGCGCCCCCTCTTCACTTCACCGTCTCCAAGTTATTGACGCCGATTT
GCGCCCTTAGGATCCCGTTCTACGGCTACATTCGATTCTTCTTCTTCCTCTACCTGATTCTGCCCCAGACACAAG
GCGCGCGCACTCTCTACGAAGAAAAGATCCACCCCTTCCTCGAGGAGAACGAGGGCTCCATCGATAAACTCATCG
CAACCACACACCAGCGCCTCCGCGCCGCCGGCTCGTCCTACCTGCTAAAGGCTATAGACTATCTCAAGACAAAAA
TCCTCGGCCTTCCTCGCTCCGAGCCGCCTCCTCCTCCGCCACCCGCTGGCCCCTCCGGCTACACCCAGTCGCTCC
TCGCCCGCTTTAGCGTTCCCACGGCGAGGCTGCCGGCCGCCGCGTACTCCGGCAACGACTTCTACAACATGCTCG
CCGGCGCCGTCTCCGCTGCCGCCGGCGGAGGTAGCCGCGCCGCTGGAAACGACTCGGCCCCCCTCATCCCGCCCG
ATCTGCGCGGCTCGGCCGAGAAGATGACCTTCATCGCCGCTCAGCGCGAACGGCTCAATGTGCTCCTCTCGGCCC
TCGACCGTGAGGCTCAGGAGCTTCAGAGAGCCGACGCTGAACAATACACATCCCGCGACGATACCCGCGACGATA
CCCGCGACGATACCCGCTCGCGCTCGCGTTCCAGCGGCGCCGGCCTGAGCAAGAGCCGCAGCGAGACCGACTTCG
AAAAGGTTGAGGCCGAGAGCGGCGACGAGGACGGCGCCGACGGGAGCCTTCGCAGGCGTCAGGTTCCCGGTGGCG
GCGCGGCAGGCAGTTCGTGGATACCTTGGGGATGGACAGCCGGTGCAGGCGCGACAAAGAGCTCTTCACGCGAGG
GATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail