Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01080
Gene name
Locationscaffold_01:4010641..4011636
Strand+
Gene length (bp)995
Transcript length (bp)513
Coding sequence length (bp)513
Protein length (aa) 171

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03061 4HBT Thioesterase superfamily 3.1E-12 61 136

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5702 0.2615 0.0434 0.0307 0.2494 0.0294 0.3901 0.2346 0.1686 0.2018

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5231
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|907
Ophiocordyceps australis map64 (Brazil) OphauB2|6987
Ophiocordyceps camponoti-floridani Ophcf2|01080 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5556
Ophiocordyceps kimflemingae Ophio5|5134
Ophiocordyceps subramaniannii Hirsu2|430

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01080
MVSKALTPTQFTKAVMRSFMAESGLERRLFPGNQFKVLSASAGRVDFELSILSSHTNRLKSLHGGTIASIVDLGG
SLAVASMGRFYTGVSTDISVTYIAPGGEAGDVLKGTAICDKMGGKLAYTRVTLVNQKGQLAAHGSHTKYVANKNV
ETPYVPPQEFSDVEDIDKVD*
Coding >Ophcf2|01080
ATGGTTTCAAAAGCGTTGACGCCGACTCAATTCACAAAGGCCGTGATGCGCTCCTTCATGGCCGAGTCAGGTCTG
GAGCGGAGGCTGTTCCCTGGAAACCAATTCAAAGTGCTGAGCGCCTCGGCCGGCCGCGTCGACTTTGAGTTGAGC
ATCCTCTCGTCACACACCAACCGACTCAAGTCGCTTCATGGCGGCACGATAGCCTCCATCGTCGACCTCGGCGGC
TCTCTCGCCGTCGCTTCCATGGGCCGCTTCTATACCGGTGTCTCGACCGATATCAGCGTAACGTACATCGCCCCT
GGCGGAGAGGCTGGTGATGTGCTCAAGGGCACCGCCATCTGCGACAAGATGGGTGGCAAACTGGCCTACACGAGA
GTCACGTTGGTCAACCAAAAGGGACAACTGGCGGCTCATGGCAGCCACACAAAATACGTTGCGAACAAGAATGTC
GAGACACCTTACGTACCGCCCCAAGAGTTCTCCGACGTGGAAGACATCGACAAAGTCGACTAG
Transcript >Ophcf2|01080
ATGGTTTCAAAAGCGTTGACGCCGACTCAATTCACAAAGGCCGTGATGCGCTCCTTCATGGCCGAGTCAGGTCTG
GAGCGGAGGCTGTTCCCTGGAAACCAATTCAAAGTGCTGAGCGCCTCGGCCGGCCGCGTCGACTTTGAGTTGAGC
ATCCTCTCGTCACACACCAACCGACTCAAGTCGCTTCATGGCGGCACGATAGCCTCCATCGTCGACCTCGGCGGC
TCTCTCGCCGTCGCTTCCATGGGCCGCTTCTATACCGGTGTCTCGACCGATATCAGCGTAACGTACATCGCCCCT
GGCGGAGAGGCTGGTGATGTGCTCAAGGGCACCGCCATCTGCGACAAGATGGGTGGCAAACTGGCCTACACGAGA
GTCACGTTGGTCAACCAAAAGGGACAACTGGCGGCTCATGGCAGCCACACAAAATACGTTGCGAACAAGAATGTC
GAGACACCTTACGTACCGCCCCAAGAGTTCTCCGACGTGGAAGACATCGACAAAGTCGACTAG
Gene >Ophcf2|01080
ATGGTTTCAAAAGCGTTGACGCCGACTCAATTCACAAAGGCCGTATGTCAGAGGCACTTCACCTGTCAGTCCAAT
GTCGCTGACTGGGTGTGCTACAGGTGATGCGCTCCTTCATGGCCGAGTCAGGTCTGGAGCGGAGGTGGGTGAATA
GACGTTTTCATTCTGTCTTCTTTTCTTCTCATGGTGAGGGACTCTGGTCAAGAGCAAGAATCTGCATGTAACCCT
GTCTCCTACATTCGCTCGAAGCGCTGAGAAAACACCAATCACTCACTTTCTATCCAGGCTGTTCCCTGGAAACCA
AGTACGACAGACAAACAGGCCCTTCAACTCCTCAATCGCTGAATCTCTTCCAGTTCAAAGTGCTGAGCGCCTCGG
CCGGCCGCGTCGACTTTGAGTTGAGCATCCTCTCGTCACACACCGTAAGCTTCGCTCTTCACAGCCGTTACCGTT
GGCTAAGGGAGTCCGAGAACCGACTCAAGTCGCTTCATGGCGGCACGATAGCCTCCATCGTCGACCTCGGCGGCT
CTCTCGCCGTCGCTTCCATGGGCCGCTTCTATACCGGTGTCTCGACCGATATCAGCGGTGCGCCACGACCTCCTC
GTGTCTCACTTGTTATGCGCTCTGCTCACACCAGGGGTCTCGACCTCCAGTAACGTACATCGCCCCTGGCGGAGA
GGCTGGTGATGTGCTCAAGGGCACCGCCATCTGCGACAAGAGTAATGCCAAACCCCTTTTCTCTATCATTCGGTT
CCTGACAGGACGGCAGTGGGTGGCAAACTGGCCTACACGAGAGTCACGTTGGTCAACCAAAAGGGACAACTGGCG
GCTCATGGCAGCCACACAAAGTATGCTGCCGCGTATAATGACTCCGGGATACGTCGATACGTCCAGCGACGCTGA
CGACCAGTAGATACGTTGCGAACAAGAATGTCGAGACACCTTACGTACCGCCCCAAGAGTTCTCCGACGTGGAAG
ACATCGACAAAGTCGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail