Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01079
Gene name
Locationscaffold_01:4008686..4010312
Strand-
Gene length (bp)1626
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03849 Tfb2 Transcription factor Tfb2 8.8E-133 13 403
PF18307 Tfb2_C Transcription factor Tfb2 (p52) C-terminal domain 4.8E-20 423 488

GO

GO Term Description Terminal node
GO:0001671 ATPase activator activity Yes
GO:0006289 nucleotide-excision repair Yes
GO:0000439 transcription factor TFIIH core complex Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0098772 molecular function regulator activity No
GO:0050896 response to stimulus No
GO:1901360 organic cyclic compound metabolic process No
GO:0032991 protein-containing complex No
GO:0043170 macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0051716 cellular response to stimulus No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:0033554 cellular response to stress No
GO:0006807 nitrogen compound metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0140677 molecular function activator activity No
GO:0006950 response to stress No
GO:0006281 DNA repair No
GO:0090575 RNA polymerase II transcription regulator complex No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005667 transcription regulator complex No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5042 0.5902 0.035 0.0565 0.0844 0.0111 0.0519 0.3082 0.14 0.0073

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2735
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|906
Ophiocordyceps australis map64 (Brazil) OphauB2|6986
Ophiocordyceps camponoti-floridani Ophcf2|01079 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5557
Ophiocordyceps kimflemingae Ophio5|5135
Ophiocordyceps subramaniannii Hirsu2|432

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01079
MASSPMKTMQLADYLERLPGTTFRKLYQQPSTAFAIFRRMLPHLAKTLVMRCLYMPKPMLLSDLDLWVRPEAKRE
KDQALSILRGLHIIQITAPSKDKPQEMFLTANFKESMRLALTGGGTHNSFGVPSTLTVPQEIDVPFLDRYARKKW
DDILHFVVSSVGFKSAGDVSGPNKSVKELLVAGRLVDRRPGGGVGITQAGFTFLLQEANAQVWTLLLLWLEASDL
NKAAGSETVDMLSFLFVLATLELGRAYDTNALTEQRKNMLPSLLDFGLIYIPQHKRSMFFPTRLATTLTNGAGGL
RSISDGVTAATTWASQQQQGSSGGLLAAAGEQRGSVIVETNYRLYAYTQSTLQIAVLALFAKLHMRFPDMVAGRL
SRASIRQAINFGISADQIVSYLAAHAHEQMHRSAAVTSKPVLPPTVVDQIRLWQLENERMKTTGGFLFRDFDDQK
EYLDTARFASEIGVCVWRSDKTGMFFASKHEQIRDYLKSRKRAE*
Coding >Ophcf2|01079
ATGGCGTCCAGTCCGATGAAGACGATGCAGCTGGCCGACTACCTGGAGAGGCTTCCGGGCACGACGTTTAGGAAG
CTCTATCAGCAGCCTTCGACGGCGTTTGCCATTTTCCGACGCATGCTGCCGCATCTGGCAAAAACGCTCGTGATG
CGCTGCTTGTATATGCCCAAGCCCATGCTCCTCAGCGACCTGGATCTCTGGGTCCGTCCCGAGGCAAAACGGGAA
AAGGACCAGGCGCTCTCAATCCTGCGAGGCCTGCACATCATACAGATCACGGCGCCGTCCAAGGATAAGCCGCAG
GAGATGTTCCTGACGGCCAACTTCAAGGAGTCGATGCGTCTCGCCCTTACTGGAGGCGGGACGCACAATTCGTTT
GGAGTCCCCTCCACGCTGACGGTGCCGCAAGAGATCGACGTGCCGTTCTTGGACCGGTACGCGCGCAAGAAGTGG
GACGACATCCTTCACTTTGTCGTCTCCAGCGTCGGCTTCAAGAGCGCGGGCGACGTCTCCGGACCGAACAAGAGC
GTCAAGGAACTGCTCGTCGCCGGCCGGCTCGTCGACAGGAGACCCGGAGGCGGCGTCGGCATCACCCAGGCCGGC
TTCACCTTTCTGCTGCAAGAGGCCAACGCCCAAGTCTGGACCCTGCTTCTGCTGTGGCTCGAGGCCAGCGACCTC
AACAAAGCGGCCGGCTCCGAGACGGTAGACATGCTCTCCTTCCTCTTCGTCCTCGCCACGCTCGAGCTGGGCAGG
GCCTACGACACCAACGCTCTGACGGAGCAGCGCAAGAACATGCTCCCCTCGCTGCTCGACTTTGGCCTCATCTAC
ATCCCCCAGCACAAACGCTCCATGTTCTTCCCCACCCGCCTAGCCACGACGCTGACCAACGGAGCCGGAGGCCTA
CGGTCCATCAGCGACGGCGTCACCGCCGCGACGACATGGGCCTCACAACAACAGCAGGGCTCATCAGGAGGCCTC
CTCGCGGCGGCGGGCGAGCAAAGGGGCAGCGTCATCGTCGAGACCAACTACCGATTATACGCCTACACGCAGTCG
ACGCTACAGATCGCCGTCCTCGCCCTCTTCGCAAAGCTTCACATGCGCTTCCCGGACATGGTGGCCGGCCGCCTC
TCCCGCGCCTCCATCCGACAAGCCATCAACTTTGGCATCTCGGCCGACCAGATCGTCTCGTACCTCGCCGCCCAC
GCCCACGAGCAGATGCACCGCTCAGCCGCCGTCACCAGCAAACCCGTGCTCCCGCCCACCGTCGTCGATCAGATC
CGGCTCTGGCAGCTGGAGAACGAACGGATGAAGACGACGGGCGGCTTCCTCTTTCGCGACTTTGACGATCAAAAG
GAATATCTCGACACGGCCAGGTTCGCGTCCGAGATTGGCGTCTGCGTCTGGCGGAGCGATAAGACGGGCATGTTC
TTCGCCAGCAAGCACGAGCAAATCCGGGATTATCTCAAGAGTCGGAAGCGCGCCGAGTAG
Transcript >Ophcf2|01079
ATGGCGTCCAGTCCGATGAAGACGATGCAGCTGGCCGACTACCTGGAGAGGCTTCCGGGCACGACGTTTAGGAAG
CTCTATCAGCAGCCTTCGACGGCGTTTGCCATTTTCCGACGCATGCTGCCGCATCTGGCAAAAACGCTCGTGATG
CGCTGCTTGTATATGCCCAAGCCCATGCTCCTCAGCGACCTGGATCTCTGGGTCCGTCCCGAGGCAAAACGGGAA
AAGGACCAGGCGCTCTCAATCCTGCGAGGCCTGCACATCATACAGATCACGGCGCCGTCCAAGGATAAGCCGCAG
GAGATGTTCCTGACGGCCAACTTCAAGGAGTCGATGCGTCTCGCCCTTACTGGAGGCGGGACGCACAATTCGTTT
GGAGTCCCCTCCACGCTGACGGTGCCGCAAGAGATCGACGTGCCGTTCTTGGACCGGTACGCGCGCAAGAAGTGG
GACGACATCCTTCACTTTGTCGTCTCCAGCGTCGGCTTCAAGAGCGCGGGCGACGTCTCCGGACCGAACAAGAGC
GTCAAGGAACTGCTCGTCGCCGGCCGGCTCGTCGACAGGAGACCCGGAGGCGGCGTCGGCATCACCCAGGCCGGC
TTCACCTTTCTGCTGCAAGAGGCCAACGCCCAAGTCTGGACCCTGCTTCTGCTGTGGCTCGAGGCCAGCGACCTC
AACAAAGCGGCCGGCTCCGAGACGGTAGACATGCTCTCCTTCCTCTTCGTCCTCGCCACGCTCGAGCTGGGCAGG
GCCTACGACACCAACGCTCTGACGGAGCAGCGCAAGAACATGCTCCCCTCGCTGCTCGACTTTGGCCTCATCTAC
ATCCCCCAGCACAAACGCTCCATGTTCTTCCCCACCCGCCTAGCCACGACGCTGACCAACGGAGCCGGAGGCCTA
CGGTCCATCAGCGACGGCGTCACCGCCGCGACGACATGGGCCTCACAACAACAGCAGGGCTCATCAGGAGGCCTC
CTCGCGGCGGCGGGCGAGCAAAGGGGCAGCGTCATCGTCGAGACCAACTACCGATTATACGCCTACACGCAGTCG
ACGCTACAGATCGCCGTCCTCGCCCTCTTCGCAAAGCTTCACATGCGCTTCCCGGACATGGTGGCCGGCCGCCTC
TCCCGCGCCTCCATCCGACAAGCCATCAACTTTGGCATCTCGGCCGACCAGATCGTCTCGTACCTCGCCGCCCAC
GCCCACGAGCAGATGCACCGCTCAGCCGCCGTCACCAGCAAACCCGTGCTCCCGCCCACCGTCGTCGATCAGATC
CGGCTCTGGCAGCTGGAGAACGAACGGATGAAGACGACGGGCGGCTTCCTCTTTCGCGACTTTGACGATCAAAAG
GAATATCTCGACACGGCCAGGTTCGCGTCCGAGATTGGCGTCTGCGTCTGGCGGAGCGATAAGACGGGCATGTTC
TTCGCCAGCAAGCACGAGCAAATCCGGGATTATCTCAAGAGTCGGAAGCGCGCCGAGTAG
Gene >Ophcf2|01079
ATGGCGTCCAGTCCGATGAAGACGATGCAGCTGGCCGACTACCTGGAGAGGCTTCCGGGCACGACGTTTAGGAAG
CTCTATCAGCAGCCTTCGACGGCGTTTGCCATTTTCCGACGCATGCTGCCGCATCTGGGTATGCTCTCCCTCTCT
GTATGAGCTTTGTCTATGTGTGAATGGCTGCTGATGTGGGATCTTTCTTTCGCAGCAAAAACGCTCGTGATGCGC
TGCTTGTATATGCCCAAGCCCATGCTCCTCAGCGACCTGGATCTCTGGGTCCGTCCCGAGGCAAAACGGTATGCA
TATGGAAGGAGGAGCCAAAAGGGTTCTGGAAGAAAAAATCAGCTGACCATATTCCCACTCAGGGAAAAGGACCAG
GCGCTCTCAATCCTGCGAGGCCTGCACATCATACAGATCACGGCGCCGTCCAAGGATAAGCCGCAGGAGATGTTC
CTGACGGCCAACTTCAAGGAGTCGATGCGTCTCGCCCTTACTGGAGGCGGGACGCACAATTCGTTTGGAGTCCCC
TCCACGCTGACGGTGCCGCAAGAGATCGACGTGCCGTTCTTGGACCGGTACGCGCGCAAGAAGTGGGACGACATC
CTTCACTTTGTCGTCTCCAGCGTCGGCTTCAAGAGCGCGGGCGACGTCTCCGGACCGAACAAGAGCGTCAAGGAA
CTGCTCGTCGCCGGCCGGCTCGTCGACAGGAGACCCGGAGGCGGCGTCGGCATCACCCAGGCCGGCTTCACCTTT
CTGCTGCAAGAGGCCAACGCCCAAGTCTGGACCCTGCTTCTGCTGTGGCTCGAGGCCAGCGACCTCAACAAAGCG
GCCGGCTCCGAGACGGTAGACATGCTCTCCTTCCTCTTCGTCCTCGCCACGCTCGAGCTGGGCAGGGCCTACGAC
ACCAACGCTCTGACGGAGCAGCGCAAGAACATGCTCCCCTCGCTGCTCGACTTTGGCCTCATCTACATCCCCCAG
CACAAACGCTCCATGTTCTTCCCCACCCGCCTAGCCACGACGCTGACCAACGGAGCCGGAGGCCTACGGTCCATC
AGCGACGGCGTCACCGCCGCGACGACATGGGCCTCACAACAACAGCAGGGCTCATCAGGAGGCCTCCTCGCGGCG
GCGGGCGAGCAAAGGGGCAGCGTCATCGTCGAGACCAACTACCGATTATACGCCTACACGCAGTCGACGCTACAG
ATCGCCGTCCTCGCCCTCTTCGCAAAGCTTCACATGCGCTTCCCGGACATGGTGGCCGGCCGCCTCTCCCGCGCC
TCCATCCGACAAGCCATCAACTTTGGCATCTCGGCCGACCAGATCGTCTCGTACCTCGCCGCCCACGCCCACGAG
CAGATGCACCGCTCAGCCGCCGTCACCAGCAAACCCGTGCTCCCGCCCACCGTCGTCGATCAGATCCGGCTCTGG
CAGCTGGAGAACGAACGGATGAAGACGACGGGCGGCTTCCTCTTTCGCGACTTTGACGATCAAAAGGAATATCTC
GACACGGCCAGGTTCGCGTCCGAGATTGGCGTCTGCGTCTGGCGGAGCGATAAGACGGGCATGTTCTTCGCCAGC
AAGCACGAGCAAATCCGGGATTATCTCAAGAGTCGGAAGCGCGCCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail