Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01072
Gene name
Locationscaffold_01:3985012..3989963
Strand+
Gene length (bp)4951
Transcript length (bp)4596
Coding sequence length (bp)4596
Protein length (aa) 1532

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 1.1E-45 504 714
PF01061 ABC2_membrane ABC-2 type transporter 1.6E-46 1202 1417
PF06422 PDR_CDR CDR ABC transporter 1.8E-32 741 825
PF00005 ABC_tran ABC transporter 7.0E-14 185 338
PF00005 ABC_tran ABC transporter 4.5E-17 891 1042
PF14510 ABC_trans_N ABC-transporter N-terminal 2.0E-12 77 155
PF19055 ABC2_membrane_7 ABC-2 type transporter 7.8E-08 1071 1155

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0042626 ATPase-coupled transmembrane transporter activity Yes
GO:0140359 ABC-type transporter activity Yes
GO:0005215 transporter activity No
GO:0097159 organic cyclic compound binding No
GO:0022804 active transmembrane transporter activity No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0031224 intrinsic component of membrane No
GO:0022857 transmembrane transporter activity No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:1901265 nucleoside phosphate binding No
GO:0005575 cellular_component No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0030554 adenyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 523 545 22
2 557 579 22
3 599 621 22
4 633 655 22
5 665 684 19
6 784 806 22
7 1219 1241 22
8 1306 1328 22
9 1343 1365 22
10 1378 1400 22
11 1495 1517 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01072
MYGINTNYDSTAASSGAPAVEWPFRPQEYQQEDGDVDTSEKRIDDVQGSTGSSSPSETPRKSRDAEMIRRSSVVQ
ALARSYSRASTVPGQNPFLAGSDSPLNPASANFSARLWARAVAELVTDNGGAFRSAGICFQGLNVYGYGESTDYQ
KDVANTWLSLAGLGRRMAGSGRRRIDILRRFDGLVRRGEMLVVLGPPGSGCSTLLKTIAGEMNGIYVDDGSYFNY
QGMTAAEMHSRHRGEAIYTAEIDVHFPQLTVGDTLTFAARARQPRKLPEGLSRNGFADHLRDVVMAMFGISHTVD
TRVGNEYVRGVSGGERKRVTISEAALSGAALQCWDNSTRGLDSANAVEFCKTLRLQTELFGSTACVSIYQAPQSA
YDLFDKAVVLYEGRQIFFGRADDAKQYFINLGFECPPRQTTPDFLTSMTSPSERMIRPDFKGKTPCTPDEFAAAW
RDSAQFAALQAEIEDYKEAHPFDGPDAEAFRASRQAQQARGQRNKSPFTLSYPQQVRLCLWRGWKRLSGDPSLTI
GALIGNSVMALIIGSVFYNLQDTTSSFFQRGALLFFACLMNAFASALEILTLYAQRPIVEKQSRYALYHPSAEAI
ASMLCDLPYKIVNSIIFNVIIYFMTNLRREPGAFFFFLLISFSTVLVMSMVFRFIGSASRSLFQALVPAALLILG
LVIFTGFVLPTRYMLGWCRWIGYIDPLGYAFESLMVNEFHGRQFRCTQYVPSAVAPNPGLASVLAQYANVGPNNR
VCSAVGAVRGNDFVSGDAYVRSSYGYEWGNRWRNFGIVIAFTVLFLFFYMVAAELVSEKKSKGEVLVYRRGHKPA
AVRHAERRRDDAEAAMANIGPIVTAQRSRTEAKEGGSGTLQKQTSVFQWHDVCYDVKVKGDLRRILDNVDGWVKP
GTLTALMGVSGAGKTTLLDCLADRTSMGVITGEMLVDGRPRDMSFQRKTGYVQQQDLHLQTTTVREALNFSALLR
QPAHIPRDEKLAYVDEVIKLLDMDEYADAVVGVPGEGLNVEQRKRLTIGVELAAKPPLLLFVDEPTSGLDSQTSW
AILDLLERLTQAGQAVLCTIHQPSAVLFQRFDRLLFLAKGGKTVYFGDIGDRAKTMIDYFERNGGHPCPAEANPA
EWMLEVIGAAPGCSTDVDWFETWRTSAEYRAVQAELETMKQRASLSSSPKETGTTVVPAAVEVDPGEYREFAAPF
AQQLRENVFRVFQQYWRTPVYIYSKTALCTLVALFIGFVFFRAPLSIQGLQNQMFALFQLLTVFGQIVQQSMPQF
VIQRSLYEARERPSKVYSWKVFMLSQIMVELPWNSLMAAIMYVCFYYPVGLYRNAEPTGAVAERGALVFLYLLAF
MLFTGSFSTFIIAGFETAEAGGNMANLMFTLCLIFCGVLATPETLPRFWIFLYRVSPFTYLVSGMLSSGIANVDV
VCADNEILRMAPLANRTCGEYLNAFARVSGGRILNPQASGGAECEYCPIASTNTFLAGVSSNYSDRWRNFGLMWV
YIGFNIVAALGVYWLARVPKKGLGRGKKAKA*
Coding >Ophcf2|01072
ATGTACGGCATAAACACAAATTACGACTCGACGGCGGCCTCGAGCGGCGCGCCGGCCGTCGAATGGCCCTTTCGC
CCCCAGGAATACCAACAAGAAGATGGAGATGTCGACACCTCTGAGAAACGCATCGACGACGTTCAAGGCTCGACC
GGCTCGTCGTCACCGTCCGAAACGCCTCGAAAGTCCCGCGACGCCGAGATGATTCGCCGCTCATCCGTCGTCCAG
GCTCTAGCGCGCTCTTATTCGCGCGCATCGACGGTTCCGGGACAGAACCCTTTCCTCGCCGGAAGCGACTCGCCG
CTGAACCCGGCGTCTGCAAATTTTAGCGCTCGTCTTTGGGCGCGGGCCGTGGCCGAATTGGTGACGGACAACGGG
GGTGCTTTTCGATCAGCTGGCATCTGCTTCCAAGGTCTCAACGTTTACGGATACGGCGAGTCGACGGATTATCAA
AAGGACGTGGCCAACACTTGGCTTTCTCTCGCTGGCCTCGGTCGTCGAATGGCCGGTTCGGGAAGGCGACGCATC
GACATCTTGCGCCGCTTCGATGGGCTCGTTCGCCGGGGCGAGATGCTCGTCGTTCTGGGCCCGCCCGGCTCAGGA
TGCTCGACGCTGCTCAAGACAATTGCGGGTGAGATGAACGGCATCTATGTCGATGACGGTTCATACTTCAACTAT
CAAGGCATGACAGCCGCCGAGATGCACTCGAGGCATCGCGGAGAGGCCATCTATACTGCAGAGATCGACGTCCAC
TTCCCGCAGTTGACGGTGGGCGATACGCTGACCTTTGCGGCTCGGGCTCGTCAGCCGCGCAAGCTGCCCGAGGGT
CTGAGTCGCAATGGCTTCGCCGACCATCTCCGCGATGTCGTCATGGCCATGTTCGGCATCTCCCACACCGTCGAC
ACGCGCGTTGGCAACGAATACGTTCGCGGCGTTTCGGGCGGCGAGCGGAAGCGTGTCACAATCTCCGAGGCGGCT
CTTTCTGGCGCGGCCCTGCAATGCTGGGATAACTCGACCCGTGGTCTCGACTCGGCCAACGCCGTCGAGTTCTGC
AAGACGCTGCGGCTGCAGACGGAGCTATTCGGCAGCACAGCCTGCGTCTCCATCTATCAGGCGCCGCAGAGTGCC
TATGATCTCTTCGACAAGGCCGTCGTTCTTTACGAGGGCCGTCAGATCTTCTTTGGTCGCGCCGACGACGCCAAG
CAGTACTTCATCAACCTCGGCTTCGAGTGTCCGCCGCGCCAGACGACGCCCGACTTCCTCACCTCCATGACCTCG
CCGTCCGAGCGAATGATCCGGCCAGACTTCAAGGGAAAGACTCCCTGCACGCCCGACGAGTTCGCAGCCGCGTGG
AGGGACAGCGCTCAGTTCGCCGCCCTCCAGGCAGAGATTGAAGACTACAAGGAGGCCCATCCCTTCGACGGGCCC
GATGCCGAGGCCTTCCGCGCCTCTCGACAGGCTCAGCAGGCCAGGGGTCAGCGCAACAAGTCACCCTTTACCCTG
TCGTACCCCCAGCAGGTGCGCCTTTGTCTCTGGCGCGGATGGAAGCGCCTGAGCGGCGACCCGAGCTTGACCATT
GGGGCCCTCATCGGTAACTCCGTCATGGCCTTGATCATCGGCAGCGTCTTTTACAACCTCCAGGATACGACGTCG
AGCTTCTTCCAGCGCGGTGCACTGCTCTTCTTTGCCTGCCTCATGAATGCGTTCGCGTCGGCTCTCGAGATCCTC
ACCCTCTACGCGCAGCGGCCCATTGTGGAAAAGCAGAGTCGATACGCTCTCTATCATCCCTCGGCCGAGGCCATT
GCCTCGATGCTGTGCGACTTGCCGTACAAGATTGTCAACTCCATAATCTTCAACGTCATCATCTACTTCATGACC
AACCTCAGACGAGAACCGGGCGCCTTTTTCTTCTTCCTACTCATCTCATTCTCTACCGTCCTCGTCATGAGCATG
GTCTTCCGCTTCATCGGTTCTGCCTCGCGCTCTCTGTTCCAGGCCCTCGTGCCCGCCGCCCTCCTGATCCTCGGT
CTCGTCATCTTCACGGGCTTCGTGCTGCCGACACGCTACATGCTCGGCTGGTGCCGCTGGATCGGCTACATCGAC
CCGCTCGGCTATGCCTTTGAGTCACTCATGGTCAACGAGTTTCACGGCCGCCAGTTCAGATGCACCCAATACGTG
CCCTCGGCCGTGGCGCCCAACCCCGGCCTGGCCAGTGTCCTCGCGCAGTACGCCAACGTCGGGCCGAACAACCGC
GTGTGCAGTGCCGTCGGCGCCGTCCGGGGTAACGACTTCGTCAGCGGTGATGCCTACGTCAGGTCGAGCTACGGC
TACGAATGGGGCAACCGCTGGCGCAACTTTGGCATCGTCATCGCCTTTACCGTCCTCTTCCTCTTCTTCTACATG
GTGGCCGCCGAGCTCGTGTCGGAGAAGAAGTCCAAGGGCGAGGTGCTCGTCTACCGGCGCGGTCACAAGCCGGCG
GCGGTCCGGCACGCGGAGCGGCGACGCGACGACGCGGAAGCCGCCATGGCCAACATCGGCCCCATCGTGACGGCC
CAGAGAAGCCGTACCGAGGCCAAGGAGGGCGGCAGTGGCACGCTGCAGAAGCAAACGTCCGTCTTCCAGTGGCAC
GATGTCTGCTACGACGTCAAGGTCAAGGGCGATCTCCGTCGCATCCTCGACAACGTCGACGGCTGGGTCAAGCCG
GGCACGCTGACGGCCCTCATGGGAGTTTCGGGGGCCGGAAAGACGACGCTGCTCGACTGCCTGGCCGACCGGACC
TCGATGGGCGTCATCACGGGCGAGATGCTCGTCGACGGTAGGCCTCGCGACATGTCGTTTCAGCGCAAGACGGGC
TACGTCCAGCAGCAGGACCTTCATCTACAGACAACGACGGTTCGAGAGGCCCTCAACTTCAGCGCTCTGCTGCGG
CAGCCGGCTCACATCCCCCGGGATGAGAAGCTGGCATACGTCGACGAGGTCATCAAGCTGCTCGACATGGACGAG
TACGCCGATGCCGTCGTCGGCGTCCCCGGCGAAGGGCTCAACGTGGAGCAGCGCAAGCGGTTGACGATTGGCGTC
GAGCTCGCGGCTAAGCCACCGCTACTACTCTTCGTCGACGAGCCGACTTCGGGCCTCGACTCGCAGACGTCTTGG
GCCATCCTCGACCTGCTGGAGAGGCTGACGCAGGCCGGCCAGGCCGTCCTGTGCACCATCCACCAGCCCTCGGCT
GTCCTCTTCCAGCGCTTCGATCGTCTCCTCTTCCTGGCCAAGGGCGGCAAGACGGTCTACTTTGGCGATATCGGC
GACAGAGCAAAGACCATGATTGACTATTTTGAGCGCAACGGCGGCCATCCCTGTCCGGCCGAGGCCAACCCGGCC
GAGTGGATGCTCGAGGTCATCGGGGCCGCGCCGGGATGCTCGACCGATGTCGACTGGTTCGAGACGTGGCGGACG
AGCGCCGAGTATCGGGCCGTCCAGGCCGAGCTCGAGACCATGAAGCAGCGGGCATCGCTGTCGTCTTCGCCCAAG
GAAACAGGAACGACGGTGGTGCCGGCAGCAGTCGAGGTCGACCCCGGCGAGTATCGCGAGTTCGCTGCCCCCTTC
GCCCAGCAGCTTCGCGAGAACGTCTTCCGCGTCTTCCAGCAGTACTGGCGCACGCCCGTCTACATCTACTCCAAG
ACGGCCCTCTGCACGCTCGTCGCCCTCTTCATCGGCTTCGTCTTCTTCAGGGCGCCCCTCAGCATCCAGGGCCTG
CAGAACCAGATGTTCGCCCTGTTCCAGCTGCTGACCGTCTTCGGCCAGATCGTGCAGCAGTCGATGCCGCAGTTC
GTCATTCAGCGGTCGCTGTACGAGGCGCGAGAGAGGCCGTCCAAGGTGTACTCGTGGAAGGTCTTTATGCTGTCG
CAGATCATGGTCGAGCTGCCGTGGAACAGTCTGATGGCGGCCATCATGTACGTCTGCTTCTATTACCCGGTCGGT
CTCTACCGCAACGCCGAACCGACGGGCGCCGTGGCCGAGCGAGGCGCCCTCGTCTTCCTCTACCTGCTGGCCTTT
ATGCTCTTCACCGGCTCCTTCTCGACCTTTATCATCGCCGGCTTCGAGACGGCCGAGGCCGGCGGTAACATGGCC
AACCTCATGTTTACGCTGTGCCTCATCTTCTGCGGCGTCCTGGCCACGCCCGAGACGCTGCCTCGCTTCTGGATC
TTTCTCTACCGCGTCTCGCCCTTTACCTACCTCGTCTCCGGCATGCTATCGTCGGGCATCGCAAACGTCGACGTC
GTCTGCGCCGACAACGAGATCCTACGCATGGCGCCGCTTGCCAACCGCACGTGTGGCGAGTACCTGAACGCCTTT
GCCCGCGTCTCGGGCGGACGAATCCTCAATCCTCAGGCGTCGGGGGGCGCTGAGTGCGAGTATTGTCCCATCGCC
AGCACCAACACCTTCCTCGCGGGCGTCAGCAGCAACTATTCCGATCGGTGGCGTAACTTTGGCCTCATGTGGGTG
TATATCGGCTTCAATATCGTCGCTGCGCTCGGTGTGTATTGGCTTGCGCGGGTGCCCAAGAAGGGGCTCGGAAGG
GGGAAGAAGGCGAAGGCTTGA
Transcript >Ophcf2|01072
ATGTACGGCATAAACACAAATTACGACTCGACGGCGGCCTCGAGCGGCGCGCCGGCCGTCGAATGGCCCTTTCGC
CCCCAGGAATACCAACAAGAAGATGGAGATGTCGACACCTCTGAGAAACGCATCGACGACGTTCAAGGCTCGACC
GGCTCGTCGTCACCGTCCGAAACGCCTCGAAAGTCCCGCGACGCCGAGATGATTCGCCGCTCATCCGTCGTCCAG
GCTCTAGCGCGCTCTTATTCGCGCGCATCGACGGTTCCGGGACAGAACCCTTTCCTCGCCGGAAGCGACTCGCCG
CTGAACCCGGCGTCTGCAAATTTTAGCGCTCGTCTTTGGGCGCGGGCCGTGGCCGAATTGGTGACGGACAACGGG
GGTGCTTTTCGATCAGCTGGCATCTGCTTCCAAGGTCTCAACGTTTACGGATACGGCGAGTCGACGGATTATCAA
AAGGACGTGGCCAACACTTGGCTTTCTCTCGCTGGCCTCGGTCGTCGAATGGCCGGTTCGGGAAGGCGACGCATC
GACATCTTGCGCCGCTTCGATGGGCTCGTTCGCCGGGGCGAGATGCTCGTCGTTCTGGGCCCGCCCGGCTCAGGA
TGCTCGACGCTGCTCAAGACAATTGCGGGTGAGATGAACGGCATCTATGTCGATGACGGTTCATACTTCAACTAT
CAAGGCATGACAGCCGCCGAGATGCACTCGAGGCATCGCGGAGAGGCCATCTATACTGCAGAGATCGACGTCCAC
TTCCCGCAGTTGACGGTGGGCGATACGCTGACCTTTGCGGCTCGGGCTCGTCAGCCGCGCAAGCTGCCCGAGGGT
CTGAGTCGCAATGGCTTCGCCGACCATCTCCGCGATGTCGTCATGGCCATGTTCGGCATCTCCCACACCGTCGAC
ACGCGCGTTGGCAACGAATACGTTCGCGGCGTTTCGGGCGGCGAGCGGAAGCGTGTCACAATCTCCGAGGCGGCT
CTTTCTGGCGCGGCCCTGCAATGCTGGGATAACTCGACCCGTGGTCTCGACTCGGCCAACGCCGTCGAGTTCTGC
AAGACGCTGCGGCTGCAGACGGAGCTATTCGGCAGCACAGCCTGCGTCTCCATCTATCAGGCGCCGCAGAGTGCC
TATGATCTCTTCGACAAGGCCGTCGTTCTTTACGAGGGCCGTCAGATCTTCTTTGGTCGCGCCGACGACGCCAAG
CAGTACTTCATCAACCTCGGCTTCGAGTGTCCGCCGCGCCAGACGACGCCCGACTTCCTCACCTCCATGACCTCG
CCGTCCGAGCGAATGATCCGGCCAGACTTCAAGGGAAAGACTCCCTGCACGCCCGACGAGTTCGCAGCCGCGTGG
AGGGACAGCGCTCAGTTCGCCGCCCTCCAGGCAGAGATTGAAGACTACAAGGAGGCCCATCCCTTCGACGGGCCC
GATGCCGAGGCCTTCCGCGCCTCTCGACAGGCTCAGCAGGCCAGGGGTCAGCGCAACAAGTCACCCTTTACCCTG
TCGTACCCCCAGCAGGTGCGCCTTTGTCTCTGGCGCGGATGGAAGCGCCTGAGCGGCGACCCGAGCTTGACCATT
GGGGCCCTCATCGGTAACTCCGTCATGGCCTTGATCATCGGCAGCGTCTTTTACAACCTCCAGGATACGACGTCG
AGCTTCTTCCAGCGCGGTGCACTGCTCTTCTTTGCCTGCCTCATGAATGCGTTCGCGTCGGCTCTCGAGATCCTC
ACCCTCTACGCGCAGCGGCCCATTGTGGAAAAGCAGAGTCGATACGCTCTCTATCATCCCTCGGCCGAGGCCATT
GCCTCGATGCTGTGCGACTTGCCGTACAAGATTGTCAACTCCATAATCTTCAACGTCATCATCTACTTCATGACC
AACCTCAGACGAGAACCGGGCGCCTTTTTCTTCTTCCTACTCATCTCATTCTCTACCGTCCTCGTCATGAGCATG
GTCTTCCGCTTCATCGGTTCTGCCTCGCGCTCTCTGTTCCAGGCCCTCGTGCCCGCCGCCCTCCTGATCCTCGGT
CTCGTCATCTTCACGGGCTTCGTGCTGCCGACACGCTACATGCTCGGCTGGTGCCGCTGGATCGGCTACATCGAC
CCGCTCGGCTATGCCTTTGAGTCACTCATGGTCAACGAGTTTCACGGCCGCCAGTTCAGATGCACCCAATACGTG
CCCTCGGCCGTGGCGCCCAACCCCGGCCTGGCCAGTGTCCTCGCGCAGTACGCCAACGTCGGGCCGAACAACCGC
GTGTGCAGTGCCGTCGGCGCCGTCCGGGGTAACGACTTCGTCAGCGGTGATGCCTACGTCAGGTCGAGCTACGGC
TACGAATGGGGCAACCGCTGGCGCAACTTTGGCATCGTCATCGCCTTTACCGTCCTCTTCCTCTTCTTCTACATG
GTGGCCGCCGAGCTCGTGTCGGAGAAGAAGTCCAAGGGCGAGGTGCTCGTCTACCGGCGCGGTCACAAGCCGGCG
GCGGTCCGGCACGCGGAGCGGCGACGCGACGACGCGGAAGCCGCCATGGCCAACATCGGCCCCATCGTGACGGCC
CAGAGAAGCCGTACCGAGGCCAAGGAGGGCGGCAGTGGCACGCTGCAGAAGCAAACGTCCGTCTTCCAGTGGCAC
GATGTCTGCTACGACGTCAAGGTCAAGGGCGATCTCCGTCGCATCCTCGACAACGTCGACGGCTGGGTCAAGCCG
GGCACGCTGACGGCCCTCATGGGAGTTTCGGGGGCCGGAAAGACGACGCTGCTCGACTGCCTGGCCGACCGGACC
TCGATGGGCGTCATCACGGGCGAGATGCTCGTCGACGGTAGGCCTCGCGACATGTCGTTTCAGCGCAAGACGGGC
TACGTCCAGCAGCAGGACCTTCATCTACAGACAACGACGGTTCGAGAGGCCCTCAACTTCAGCGCTCTGCTGCGG
CAGCCGGCTCACATCCCCCGGGATGAGAAGCTGGCATACGTCGACGAGGTCATCAAGCTGCTCGACATGGACGAG
TACGCCGATGCCGTCGTCGGCGTCCCCGGCGAAGGGCTCAACGTGGAGCAGCGCAAGCGGTTGACGATTGGCGTC
GAGCTCGCGGCTAAGCCACCGCTACTACTCTTCGTCGACGAGCCGACTTCGGGCCTCGACTCGCAGACGTCTTGG
GCCATCCTCGACCTGCTGGAGAGGCTGACGCAGGCCGGCCAGGCCGTCCTGTGCACCATCCACCAGCCCTCGGCT
GTCCTCTTCCAGCGCTTCGATCGTCTCCTCTTCCTGGCCAAGGGCGGCAAGACGGTCTACTTTGGCGATATCGGC
GACAGAGCAAAGACCATGATTGACTATTTTGAGCGCAACGGCGGCCATCCCTGTCCGGCCGAGGCCAACCCGGCC
GAGTGGATGCTCGAGGTCATCGGGGCCGCGCCGGGATGCTCGACCGATGTCGACTGGTTCGAGACGTGGCGGACG
AGCGCCGAGTATCGGGCCGTCCAGGCCGAGCTCGAGACCATGAAGCAGCGGGCATCGCTGTCGTCTTCGCCCAAG
GAAACAGGAACGACGGTGGTGCCGGCAGCAGTCGAGGTCGACCCCGGCGAGTATCGCGAGTTCGCTGCCCCCTTC
GCCCAGCAGCTTCGCGAGAACGTCTTCCGCGTCTTCCAGCAGTACTGGCGCACGCCCGTCTACATCTACTCCAAG
ACGGCCCTCTGCACGCTCGTCGCCCTCTTCATCGGCTTCGTCTTCTTCAGGGCGCCCCTCAGCATCCAGGGCCTG
CAGAACCAGATGTTCGCCCTGTTCCAGCTGCTGACCGTCTTCGGCCAGATCGTGCAGCAGTCGATGCCGCAGTTC
GTCATTCAGCGGTCGCTGTACGAGGCGCGAGAGAGGCCGTCCAAGGTGTACTCGTGGAAGGTCTTTATGCTGTCG
CAGATCATGGTCGAGCTGCCGTGGAACAGTCTGATGGCGGCCATCATGTACGTCTGCTTCTATTACCCGGTCGGT
CTCTACCGCAACGCCGAACCGACGGGCGCCGTGGCCGAGCGAGGCGCCCTCGTCTTCCTCTACCTGCTGGCCTTT
ATGCTCTTCACCGGCTCCTTCTCGACCTTTATCATCGCCGGCTTCGAGACGGCCGAGGCCGGCGGTAACATGGCC
AACCTCATGTTTACGCTGTGCCTCATCTTCTGCGGCGTCCTGGCCACGCCCGAGACGCTGCCTCGCTTCTGGATC
TTTCTCTACCGCGTCTCGCCCTTTACCTACCTCGTCTCCGGCATGCTATCGTCGGGCATCGCAAACGTCGACGTC
GTCTGCGCCGACAACGAGATCCTACGCATGGCGCCGCTTGCCAACCGCACGTGTGGCGAGTACCTGAACGCCTTT
GCCCGCGTCTCGGGCGGACGAATCCTCAATCCTCAGGCGTCGGGGGGCGCTGAGTGCGAGTATTGTCCCATCGCC
AGCACCAACACCTTCCTCGCGGGCGTCAGCAGCAACTATTCCGATCGGTGGCGTAACTTTGGCCTCATGTGGGTG
TATATCGGCTTCAATATCGTCGCTGCGCTCGGTGTGTATTGGCTTGCGCGGGTGCCCAAGAAGGGGCTCGGAAGG
GGGAAGAAGGCGAAGGCTTGA
Gene >Ophcf2|01072
ATGTACGGCATAAACACAAATTACGACTCGACGGCGGCCTCGAGCGGCGCGCCGGCCGTCGAATGGCCCTTTCGC
CCCCAGGAATACCAACAAGAAGATGGAGATGTCGACACCTCTGAGAAACGCATCGACGACGTTCAAGGCTCGACC
GGCTCGTCGTCACCGTCCGAAACGCCTCGAAAGTCCCGCGACGCCGAGATGATTCGCCGCTCATCCGTCGTCCAG
GCTCTAGCGCGCTCTTATTCGCGCGCATCGACGGTTCCGGGACAGAACCCTTTCCTCGCCGGAAGCGACTCGCCG
CTGAACCCGGCGTCTGCAAATTTTAGCGCTCGTCTTTGGGCGCGGGCCGTGGCCGAATTGGTGACGGACAACGGG
GGTGCTTTTCGATCAGCTGGCATCTGCTTCCAAGGTCTCAACGTTTACGGATACGGCGAGTCGACGGATTATCAA
AAGGACGTGGCCAACACTTGGCTTTCTCTCGCTGGCCTCGGTCGTCGAATGGCCGGTTCGGGAAGGCGACGCATC
GACATCTTGCGCCGCTTCGATGGGCTCGTTCGCCGGGGCGAGATGCTCGTCGTTCTGGGCCCGCCCGGCTCAGGA
TGCTCGACGCTGCTCAAGACAATTGCGGGTGAGATGAACGGCATCTATGTCGATGACGGTTCATACTTCAACTAT
CAAGGTATGTATGTATGTGTGTGTCTGTTTGTGGTGCGACGTGTGACGGCCTCGGATCTGCGACGCCGAACAAGC
TTCTTCTTCCCTCAGAGCAGCTCAACCAACCGTCATGTGACCGACCAACGGGTCACCATCCCGCCGTTGGTCACC
TCATCACATGTCTTTTATGTTGTCTTTTGCACAAAACAGCTGCTGCTGAGAATGTGGAGCACAATCGATAGCCCA
TTGGGTGGCCCCGATCTGATGTGTGTGTGGGGGGTGGGGGGGGGGGCTCACGGCTGACGTAACCCAATACAGGCA
TGACAGCCGCCGAGATGCACTCGAGGCATCGCGGAGAGGCCATCTATACTGCAGAGATCGACGTCCACTTCCCGC
AGTTGACGGTGGGCGATACGCTGACCTTTGCGGCTCGGGCTCGTCAGCCGCGCAAGCTGCCCGAGGGTCTGAGTC
GCAATGGCTTCGCCGACCATCTCCGCGATGTCGTCATGGCCATGTTCGGCATCTCCCACACCGTCGACACGCGCG
TTGGCAACGAATACGTTCGCGGCGTTTCGGGCGGCGAGCGGAAGCGTGTCACAATCTCCGAGGCGGCTCTTTCTG
GCGCGGCCCTGCAATGCTGGGATAACTCGACCCGTGGTCTCGACTCGGCCAACGCCGTCGAGTTCTGCAAGACGC
TGCGGCTGCAGACGGAGCTATTCGGCAGCACAGCCTGCGTCTCCATCTATCAGGCGCCGCAGAGTGCCTATGATC
TCTTCGACAAGGCCGTCGTTCTTTACGAGGGCCGTCAGATCTTCTTTGGTCGCGCCGACGACGCCAAGCAGTACT
TCATCAACCTCGGCTTCGAGTGTCCGCCGCGCCAGACGACGCCCGACTTCCTCACCTCCATGACCTCGCCGTCCG
AGCGAATGATCCGGCCAGACTTCAAGGGAAAGACTCCCTGCACGCCCGACGAGTTCGCAGCCGCGTGGAGGGACA
GCGCTCAGTTCGCCGCCCTCCAGGCAGAGATTGAAGACTACAAGGAGGCCCATCCCTTCGACGGGCCCGATGCCG
AGGCCTTCCGCGCCTCTCGACAGGCTCAGCAGGCCAGGGGTCAGCGCAACAAGTCACCCTTTACCCTGTCGTACC
CCCAGCAGGTGCGCCTTTGTCTCTGGCGCGGATGGAAGCGCCTGAGCGGCGACCCGAGCTTGACCATTGGGGCCC
TCATCGGTAACTCCGTCATGGCCTTGATCATCGGCAGCGTCTTTTACAACCTCCAGGATACGACGTCGAGCTTCT
TCCAGCGCGGTGCACTGCTCTTCTTTGCCTGCCTCATGAATGCGTTCGCGTCGGCTCTCGAGGTCTGCTGCCCCC
TTTTCTCAGCCACGGCCCACGGGACAAGATGCAGCTAACCGTTGCGCAGATCCTCACCCTCTACGCGCAGCGGCC
CATTGTGGAAAAGCAGAGTCGATACGCTCTCTATCATCCCTCGGCCGAGGCCATTGCCTCGATGCTGTGCGACTT
GCCGTACAAGATTGTCAACTCCATAATCTTCAACGTCATCATCTACTTCATGACCAACCTCAGACGAGAACCGGG
CGCCTTTTTCTTCTTCCTACTCATCTCATTCTCTACCGTCCTCGTCATGAGCATGGTCTTCCGCTTCATCGGTTC
TGCCTCGCGCTCTCTGTTCCAGGCCCTCGTGCCCGCCGCCCTCCTGATCCTCGGTCTCGTCATCTTCACGGGCTT
CGTGCTGCCGACACGCTACATGCTCGGCTGGTGCCGCTGGATCGGCTACATCGACCCGCTCGGCTATGCCTTTGA
GTCACTCATGGTCAACGAGTTTCACGGCCGCCAGTTCAGATGCACCCAATACGTGCCCTCGGCCGTGGCGCCCAA
CCCCGGCCTGGCCAGTGTCCTCGCGCAGTACGCCAACGTCGGGCCGAACAACCGCGTGTGCAGTGCCGTCGGCGC
CGTCCGGGGTAACGACTTCGTCAGCGGTGATGCCTACGTCAGGTCGAGCTACGGCTACGAATGGGGCAACCGCTG
GCGCAACTTTGGCATCGTCATCGCCTTTACCGTCCTCTTCCTCTTCTTCTACATGGTGGCCGCCGAGCTCGTGTC
GGAGAAGAAGTCCAAGGGCGAGGTGCTCGTCTACCGGCGCGGTCACAAGCCGGCGGCGGTCCGGCACGCGGAGCG
GCGACGCGACGACGCGGAAGCCGCCATGGCCAACATCGGCCCCATCGTGACGGCCCAGAGAAGCCGTACCGAGGC
CAAGGAGGGCGGCAGTGGCACGCTGCAGAAGCAAACGTCCGTCTTCCAGTGGCACGATGTCTGCTACGACGTCAA
GGTCAAGGGCGATCTCCGTCGCATCCTCGACAACGTCGACGGCTGGGTCAAGCCGGGCACGCTGACGGCCCTCAT
GGGAGTTTCGGGGGCCGGAAAGACGACGCTGCTCGACTGCCTGGCCGACCGGACCTCGATGGGCGTCATCACGGG
CGAGATGCTCGTCGACGGTAGGCCTCGCGACATGTCGTTTCAGCGCAAGACGGGCTACGTCCAGCAGCAGGACCT
TCATCTACAGACAACGACGGTTCGAGAGGCCCTCAACTTCAGCGCTCTGCTGCGGCAGCCGGCTCACATCCCCCG
GGATGAGAAGCTGGCATACGTCGACGAGGTCATCAAGCTGCTCGACATGGACGAGTACGCCGATGCCGTCGTCGG
CGTCCCCGGCGAAGGGCTCAACGTGGAGCAGCGCAAGCGGTTGACGATTGGCGTCGAGCTCGCGGCTAAGCCACC
GCTACTACTCTTCGTCGACGAGCCGACTTCGGGCCTCGACTCGCAGACGTCTTGGGCCATCCTCGACCTGCTGGA
GAGGCTGACGCAGGCCGGCCAGGCCGTCCTGTGCACCATCCACCAGCCCTCGGCTGTCCTCTTCCAGCGCTTCGA
TCGTCTCCTCTTCCTGGCCAAGGGCGGCAAGACGGTCTACTTTGGCGATATCGGCGACAGAGCAAAGACCATGAT
TGACTATTTTGAGCGCAACGGCGGCCATCCCTGTCCGGCCGAGGCCAACCCGGCCGAGTGGATGCTCGAGGTCAT
CGGGGCCGCGCCGGGATGCTCGACCGATGTCGACTGGTTCGAGACGTGGCGGACGAGCGCCGAGTATCGGGCCGT
CCAGGCCGAGCTCGAGACCATGAAGCAGCGGGCATCGCTGTCGTCTTCGCCCAAGGAAACAGGAACGACGGTGGT
GCCGGCAGCAGTCGAGGTCGACCCCGGCGAGTATCGCGAGTTCGCTGCCCCCTTCGCCCAGCAGCTTCGCGAGAA
CGTCTTCCGCGTCTTCCAGCAGTACTGGCGCACGCCCGTCTACATCTACTCCAAGACGGCCCTCTGCACGCTCGT
CGCCCTCTTCATCGGCTTCGTCTTCTTCAGGGCGCCCCTCAGCATCCAGGGCCTGCAGAACCAGATGTTCGCCCT
GTTCCAGCTGCTGACCGTCTTCGGCCAGATCGTGCAGCAGTCGATGCCGCAGTTCGTCATTCAGCGGTCGCTGTA
CGAGGCGCGAGAGAGGCCGTCCAAGGTGTACTCGTGGAAGGTCTTTATGCTGTCGCAGATCATGGTCGAGCTGCC
GTGGAACAGTCTGATGGCGGCCATCATGTACGTCTGCTTCTATTACCCGGTCGGTCTCTACCGCAACGCCGAACC
GACGGGCGCCGTGGCCGAGCGAGGCGCCCTCGTCTTCCTCTACCTGCTGGCCTTTATGCTCTTCACCGGCTCCTT
CTCGACCTTTATCATCGCCGGCTTCGAGACGGCCGAGGCCGGCGGTAACATGGCCAACCTCATGTTTACGCTGTG
CCTCATCTTCTGCGGCGTCCTGGCCACGCCCGAGACGCTGCCTCGCTTCTGGATCTTTCTCTACCGCGTCTCGCC
CTTTACCTACCTCGTCTCCGGCATGCTATCGTCGGGCATCGCAAACGTCGACGTCGTCTGCGCCGACAACGAGAT
CCTACGCATGGCGCCGCTTGCCAACCGCACGTGTGGCGAGTACCTGAACGCCTTTGCCCGCGTCTCGGGCGGACG
AATCCTCAATCCTCAGGCGTCGGGGGGCGCTGAGTGCGAGTATTGTCCCATCGCCAGCACCAACACCTTCCTCGC
GGGCGTCAGCAGCAACTATTCCGATCGGTGGCGTAACTTTGGCCTCATGTGGGTGTATATCGGCTTCAATATCGT
CGCTGCGCTCGGTGTGTATTGGCTTGCGCGGGTGCCCAAGAAGGGGCTCGGAAGGGGGAAGAAGGCGAAGGCTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail