Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01068
Gene name
Locationscaffold_01:3973420..3978252
Strand-
Gene length (bp)4832
Transcript length (bp)3486
Coding sequence length (bp)3486
Protein length (aa) 1162

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.0735 0.2483 0.0087 0.0293 0.499 0.3851 0.2586 0.0827 0.0638 0.3847

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 986 1008 22
2 1020 1042 22
3 1052 1071 19
4 1106 1123 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 45.53 25.44 65.61
Alive In ants, during behavior modification 102.11 51.06 153.16
Dead In ants, recently dead 85.35 44.05 126.66

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.349401 no
Dead Fungus 0.001226 yes

Orthologs

Orthofinder run ID4
Orthogroup5435
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7304
Ophiocordyceps australis map64 (Brazil) OphauB2|7000
Ophiocordyceps camponoti-floridani Ophcf2|01068 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4006
Ophiocordyceps kimflemingae Ophio5|8545
Ophiocordyceps subramaniannii Hirsu2|597

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01068
MAPSNGAARPQPPARSKQAVKPVVPLPYIKRQPAPVAVISPPICHGTGVATNGHVDDASPITPADVSEPSPSIVS
NGGVFAPHEPGLETAANNGLAKAHEPPFLPQAASPTHNHQHPSNGSIYFGTLDDSQGSSPAPPPSGGIPPPPGMA
GPEGRPPYLGPAGNGFAPMMPFPGEVMPMNNVDSFGRPTAGYGHGDPFPAYGANYGPSTPRSFHDSQSSGHPDDG
AMFGHYSHRNGGPIMGDDINTQRRMLGPLGLFPGLGIPPPMPPGNLENGLIGYLQQQFARPESADCTLELRYPAD
RAPPVRIPAHRLILCRSADLAIRLQQTASDAAAPPTVVVEGCGRWMRSDAFYTAAQSLYGLPLLQMPLHGRADPG
DVMEAGPVKEQLDFCLSYAAAGYLIGWWPVTRRGCEVAMQLLGWPTLETTVDFALDGFVDMGSHDVYKLGEGSRT
LLMAVISFIVHNLPPTFSIDTTVEDSESYHRLPVRLPAPASSANTVEASPPAMTTRVPSVQFGKGRRPQQISHIQ
FGDLSMSESETPKATRIPQPASHAILSRVLLNLPFSQLKMLVELPPSSANLHGWVAMAHTVKAAVVEREVRRQKS
VEAVIDGRVTVSDAVKAALRSPTPQDAGQWSLLGWQEEMMFVDPVLRNALRYTVSAREYALLHRHVLSRARAVRR
NVPGPASVERALAPKQGHGIGHDYNAKAVRHALRVFSASWLGLRGYEAVVKRIGARGKRSASKTPAVRLSLSLSA
VLLIYRLLYRFLSRLRAQLLHSQAEPFRKRNPRVAAALTSTYAPAVGASLAGLALGGCPAQQLRVSIALWALFRA
LEFGWNSCEADGLVWGSKNGKKRERPWWFGSWLLQPFSFGQLLHACVFDRDCFPETYGSFIFKQSPVYLHQRPKD
WPSHRLWPDAPQIVTSLAEMARLNWPAYISPTLFPQKESLPPSLQTVAPLTWRAHPLLSSLSCATLHPSDPSCLR
TYLTFWLDSFPPMARFFLALCSALTLLSRARAFHDRPLATTQRIVARALGMSTFATGAISTAWASICLFQTWLPR
HVLATRRFFLGGFLAGLWAWVERRHGRSVFLYSARASVDSLWKVGVKRRWWRAMRGGDVWVFALALMLTGVVYER
DARAIREARWRKGVSWLRGEGWRDWAGRMGMRRWGG*
Coding >Ophcf2|01068
ATGGCTCCGTCCAACGGCGCGGCCAGGCCTCAGCCTCCTGCTCGTTCGAAGCAGGCCGTCAAGCCCGTCGTGCCT
CTGCCCTACATTAAACGTCAGCCGGCTCCTGTGGCTGTTATTTCGCCGCCTATCTGCCATGGGACGGGAGTGGCC
ACCAATGGTCACGTTGATGATGCGTCTCCCATCACCCCTGCCGATGTTTCCGAACCGTCGCCTTCCATAGTCTCC
AACGGAGGAGTCTTTGCTCCGCATGAGCCCGGACTCGAGACTGCAGCCAACAACGGGCTCGCCAAGGCTCATGAG
CCACCCTTTCTCCCTCAGGCCGCTTCGCCCACGCATAACCATCAGCATCCGAGCAACGGTAGCATCTACTTTGGA
ACTCTCGACGACTCCCAGGGCTCGTCTCCTGCGCCGCCACCCTCGGGGGGCATTCCTCCGCCGCCAGGCATGGCA
GGCCCCGAAGGTCGACCGCCCTACTTGGGCCCTGCTGGCAACGGCTTTGCGCCCATGATGCCCTTTCCCGGCGAA
GTCATGCCCATGAACAACGTGGACAGTTTTGGCCGTCCGACCGCTGGCTACGGCCATGGCGATCCCTTTCCTGCC
TACGGCGCAAACTACGGCCCTTCGACACCTCGCAGTTTCCACGATTCGCAGTCGTCTGGTCATCCCGATGACGGA
GCCATGTTTGGCCACTATTCGCATCGCAACGGAGGACCCATCATGGGCGACGACATCAACACCCAGCGACGCATG
TTAGGTCCCCTGGGACTGTTCCCTGGCTTGGGCATCCCGCCCCCGATGCCGCCCGGCAACTTGGAGAATGGTCTG
ATTGGATATCTGCAGCAGCAGTTCGCCCGTCCCGAATCCGCCGATTGTACCCTGGAGCTTCGATATCCCGCCGAC
AGGGCGCCGCCTGTGCGCATCCCCGCCCACCGCCTTATTCTCTGTCGCAGTGCCGATCTCGCCATCAGGCTTCAG
CAGACAGCCTCGGACGCCGCCGCTCCACCAACCGTCGTCGTTGAAGGCTGTGGCCGGTGGATGCGGTCCGACGCC
TTCTACACGGCTGCTCAGTCATTATACGGCCTCCCGCTCCTGCAGATGCCGCTGCATGGTCGTGCGGATCCGGGT
GACGTGATGGAGGCCGGACCGGTCAAAGAGCAGCTCGACTTCTGCCTGAGCTACGCCGCGGCCGGCTACCTCATC
GGCTGGTGGCCCGTCACGAGACGTGGCTGCGAAGTGGCGATGCAACTACTGGGCTGGCCTACGCTGGAGACGACT
GTCGATTTCGCACTCGACGGTTTCGTCGACATGGGCTCGCACGATGTGTACAAGCTCGGGGAGGGGTCGCGGACC
TTGCTCATGGCCGTCATCAGCTTCATCGTGCATAACCTCCCGCCGACCTTTAGCATCGACACGACTGTCGAGGAC
TCTGAAAGCTACCATCGACTTCCGGTCCGACTTCCGGCACCGGCCTCGTCTGCAAATACTGTCGAGGCCAGCCCG
CCTGCGATGACGACGAGGGTGCCGTCGGTGCAGTTCGGCAAGGGTCGTCGGCCGCAGCAGATTTCCCACATTCAA
TTCGGGGATCTCTCCATGTCCGAGTCGGAAACGCCCAAGGCGACGCGGATTCCTCAGCCGGCATCGCACGCGATC
CTATCGCGCGTCCTTCTCAACCTTCCATTTTCGCAACTGAAGATGCTCGTCGAGTTGCCGCCCTCATCAGCCAAC
CTACACGGCTGGGTGGCAATGGCCCACACCGTCAAGGCGGCGGTCGTTGAGCGCGAGGTTCGACGCCAGAAGTCG
GTCGAGGCCGTCATCGACGGGCGAGTCACCGTCTCGGATGCGGTCAAGGCGGCGCTGCGCAGCCCGACTCCACAG
GATGCAGGGCAATGGAGCCTCCTGGGCTGGCAGGAGGAGATGATGTTCGTGGACCCGGTACTGCGCAACGCACTG
AGATACACCGTCTCGGCGCGAGAGTACGCTCTCCTCCATCGGCATGTGCTCTCGCGGGCGCGGGCGGTGCGTCGA
AACGTGCCGGGTCCGGCCAGCGTCGAGCGGGCGCTGGCGCCGAAGCAGGGCCACGGAATCGGCCACGATTATAAT
GCCAAGGCTGTGCGGCATGCCTTGCGAGTGTTTTCTGCTTCTTGGTTGGGGCTGAGGGGGTATGAGGCCGTGGTG
AAGAGGATTGGGGCAAGGGGAAAGCGCTCAGCCTCAAAGACGCCGGCGGTGCGGCTCTCGCTCTCGCTCTCGGCG
GTGCTGCTCATATACCGTCTCCTGTACCGGTTCTTATCACGGCTGCGAGCTCAACTGCTTCACTCGCAGGCTGAG
CCCTTCCGGAAGCGCAACCCTCGGGTGGCAGCGGCCCTGACGTCGACCTATGCGCCGGCTGTTGGCGCATCGTTG
GCCGGGCTCGCCCTGGGAGGGTGTCCGGCGCAGCAGTTGCGCGTCTCCATCGCGCTGTGGGCTCTCTTCCGCGCC
CTCGAGTTTGGTTGGAACTCGTGCGAGGCTGATGGGCTCGTGTGGGGGTCGAAGAACGGGAAGAAGAGGGAGCGG
CCTTGGTGGTTTGGGAGCTGGTTGTTGCAACCGTTTTCGTTTGGCCAGCTGCTGCACGCCTGCGTCTTCGACCGA
GATTGCTTCCCCGAGACGTACGGCAGCTTCATCTTCAAGCAGTCGCCCGTCTACTTGCACCAACGACCGAAAGAC
TGGCCCTCACACAGGCTGTGGCCGGACGCGCCGCAGATTGTCACCAGCCTGGCCGAGATGGCGCGGCTGAACTGG
CCGGCCTACATCTCGCCGACTCTGTTCCCGCAAAAGGAGAGCCTCCCCCCCTCGCTACAGACGGTGGCGCCCCTG
ACATGGCGCGCCCACCCGCTGTTGTCGTCGCTATCGTGCGCGACGCTACACCCGTCAGACCCGTCGTGTCTGCGA
ACGTACCTCACCTTTTGGCTCGACTCGTTCCCGCCGATGGCGCGCTTCTTCCTGGCGCTGTGCTCGGCGCTGACG
TTGCTGTCGCGAGCGCGGGCCTTTCACGACCGGCCGCTGGCTACGACACAGCGCATCGTGGCGCGAGCGTTGGGC
ATGTCGACGTTCGCGACGGGCGCCATCTCGACGGCCTGGGCGTCGATATGCCTGTTCCAGACCTGGCTTCCACGC
CACGTGCTGGCAACGCGGCGATTCTTCCTCGGCGGCTTCCTGGCAGGTCTCTGGGCGTGGGTCGAGCGCCGACAC
GGCCGAAGCGTCTTCCTGTACAGCGCCAGGGCGAGCGTCGACTCGCTGTGGAAGGTGGGCGTCAAGCGTCGGTGG
TGGCGGGCCATGCGCGGAGGAGACGTCTGGGTGTTTGCCCTGGCGCTCATGCTCACGGGCGTGGTGTACGAGCGT
GATGCCAGGGCTATCCGCGAGGCGCGCTGGCGGAAGGGCGTGAGTTGGCTTAGGGGGGAGGGGTGGAGGGATTGG
GCGGGGAGGATGGGGATGAGGAGGTGGGGAGGATGA
Transcript >Ophcf2|01068
ATGGCTCCGTCCAACGGCGCGGCCAGGCCTCAGCCTCCTGCTCGTTCGAAGCAGGCCGTCAAGCCCGTCGTGCCT
CTGCCCTACATTAAACGTCAGCCGGCTCCTGTGGCTGTTATTTCGCCGCCTATCTGCCATGGGACGGGAGTGGCC
ACCAATGGTCACGTTGATGATGCGTCTCCCATCACCCCTGCCGATGTTTCCGAACCGTCGCCTTCCATAGTCTCC
AACGGAGGAGTCTTTGCTCCGCATGAGCCCGGACTCGAGACTGCAGCCAACAACGGGCTCGCCAAGGCTCATGAG
CCACCCTTTCTCCCTCAGGCCGCTTCGCCCACGCATAACCATCAGCATCCGAGCAACGGTAGCATCTACTTTGGA
ACTCTCGACGACTCCCAGGGCTCGTCTCCTGCGCCGCCACCCTCGGGGGGCATTCCTCCGCCGCCAGGCATGGCA
GGCCCCGAAGGTCGACCGCCCTACTTGGGCCCTGCTGGCAACGGCTTTGCGCCCATGATGCCCTTTCCCGGCGAA
GTCATGCCCATGAACAACGTGGACAGTTTTGGCCGTCCGACCGCTGGCTACGGCCATGGCGATCCCTTTCCTGCC
TACGGCGCAAACTACGGCCCTTCGACACCTCGCAGTTTCCACGATTCGCAGTCGTCTGGTCATCCCGATGACGGA
GCCATGTTTGGCCACTATTCGCATCGCAACGGAGGACCCATCATGGGCGACGACATCAACACCCAGCGACGCATG
TTAGGTCCCCTGGGACTGTTCCCTGGCTTGGGCATCCCGCCCCCGATGCCGCCCGGCAACTTGGAGAATGGTCTG
ATTGGATATCTGCAGCAGCAGTTCGCCCGTCCCGAATCCGCCGATTGTACCCTGGAGCTTCGATATCCCGCCGAC
AGGGCGCCGCCTGTGCGCATCCCCGCCCACCGCCTTATTCTCTGTCGCAGTGCCGATCTCGCCATCAGGCTTCAG
CAGACAGCCTCGGACGCCGCCGCTCCACCAACCGTCGTCGTTGAAGGCTGTGGCCGGTGGATGCGGTCCGACGCC
TTCTACACGGCTGCTCAGTCATTATACGGCCTCCCGCTCCTGCAGATGCCGCTGCATGGTCGTGCGGATCCGGGT
GACGTGATGGAGGCCGGACCGGTCAAAGAGCAGCTCGACTTCTGCCTGAGCTACGCCGCGGCCGGCTACCTCATC
GGCTGGTGGCCCGTCACGAGACGTGGCTGCGAAGTGGCGATGCAACTACTGGGCTGGCCTACGCTGGAGACGACT
GTCGATTTCGCACTCGACGGTTTCGTCGACATGGGCTCGCACGATGTGTACAAGCTCGGGGAGGGGTCGCGGACC
TTGCTCATGGCCGTCATCAGCTTCATCGTGCATAACCTCCCGCCGACCTTTAGCATCGACACGACTGTCGAGGAC
TCTGAAAGCTACCATCGACTTCCGGTCCGACTTCCGGCACCGGCCTCGTCTGCAAATACTGTCGAGGCCAGCCCG
CCTGCGATGACGACGAGGGTGCCGTCGGTGCAGTTCGGCAAGGGTCGTCGGCCGCAGCAGATTTCCCACATTCAA
TTCGGGGATCTCTCCATGTCCGAGTCGGAAACGCCCAAGGCGACGCGGATTCCTCAGCCGGCATCGCACGCGATC
CTATCGCGCGTCCTTCTCAACCTTCCATTTTCGCAACTGAAGATGCTCGTCGAGTTGCCGCCCTCATCAGCCAAC
CTACACGGCTGGGTGGCAATGGCCCACACCGTCAAGGCGGCGGTCGTTGAGCGCGAGGTTCGACGCCAGAAGTCG
GTCGAGGCCGTCATCGACGGGCGAGTCACCGTCTCGGATGCGGTCAAGGCGGCGCTGCGCAGCCCGACTCCACAG
GATGCAGGGCAATGGAGCCTCCTGGGCTGGCAGGAGGAGATGATGTTCGTGGACCCGGTACTGCGCAACGCACTG
AGATACACCGTCTCGGCGCGAGAGTACGCTCTCCTCCATCGGCATGTGCTCTCGCGGGCGCGGGCGGTGCGTCGA
AACGTGCCGGGTCCGGCCAGCGTCGAGCGGGCGCTGGCGCCGAAGCAGGGCCACGGAATCGGCCACGATTATAAT
GCCAAGGCTGTGCGGCATGCCTTGCGAGTGTTTTCTGCTTCTTGGTTGGGGCTGAGGGGGTATGAGGCCGTGGTG
AAGAGGATTGGGGCAAGGGGAAAGCGCTCAGCCTCAAAGACGCCGGCGGTGCGGCTCTCGCTCTCGCTCTCGGCG
GTGCTGCTCATATACCGTCTCCTGTACCGGTTCTTATCACGGCTGCGAGCTCAACTGCTTCACTCGCAGGCTGAG
CCCTTCCGGAAGCGCAACCCTCGGGTGGCAGCGGCCCTGACGTCGACCTATGCGCCGGCTGTTGGCGCATCGTTG
GCCGGGCTCGCCCTGGGAGGGTGTCCGGCGCAGCAGTTGCGCGTCTCCATCGCGCTGTGGGCTCTCTTCCGCGCC
CTCGAGTTTGGTTGGAACTCGTGCGAGGCTGATGGGCTCGTGTGGGGGTCGAAGAACGGGAAGAAGAGGGAGCGG
CCTTGGTGGTTTGGGAGCTGGTTGTTGCAACCGTTTTCGTTTGGCCAGCTGCTGCACGCCTGCGTCTTCGACCGA
GATTGCTTCCCCGAGACGTACGGCAGCTTCATCTTCAAGCAGTCGCCCGTCTACTTGCACCAACGACCGAAAGAC
TGGCCCTCACACAGGCTGTGGCCGGACGCGCCGCAGATTGTCACCAGCCTGGCCGAGATGGCGCGGCTGAACTGG
CCGGCCTACATCTCGCCGACTCTGTTCCCGCAAAAGGAGAGCCTCCCCCCCTCGCTACAGACGGTGGCGCCCCTG
ACATGGCGCGCCCACCCGCTGTTGTCGTCGCTATCGTGCGCGACGCTACACCCGTCAGACCCGTCGTGTCTGCGA
ACGTACCTCACCTTTTGGCTCGACTCGTTCCCGCCGATGGCGCGCTTCTTCCTGGCGCTGTGCTCGGCGCTGACG
TTGCTGTCGCGAGCGCGGGCCTTTCACGACCGGCCGCTGGCTACGACACAGCGCATCGTGGCGCGAGCGTTGGGC
ATGTCGACGTTCGCGACGGGCGCCATCTCGACGGCCTGGGCGTCGATATGCCTGTTCCAGACCTGGCTTCCACGC
CACGTGCTGGCAACGCGGCGATTCTTCCTCGGCGGCTTCCTGGCAGGTCTCTGGGCGTGGGTCGAGCGCCGACAC
GGCCGAAGCGTCTTCCTGTACAGCGCCAGGGCGAGCGTCGACTCGCTGTGGAAGGTGGGCGTCAAGCGTCGGTGG
TGGCGGGCCATGCGCGGAGGAGACGTCTGGGTGTTTGCCCTGGCGCTCATGCTCACGGGCGTGGTGTACGAGCGT
GATGCCAGGGCTATCCGCGAGGCGCGCTGGCGGAAGGGCGTGAGTTGGCTTAGGGGGGAGGGGTGGAGGGATTGG
GCGGGGAGGATGGGGATGAGGAGGTGGGGAGGATGA
Gene >Ophcf2|01068
ATGGCTCCGTCCAACGGCGCGGCCAGGCCTCAGCCTCCTGCTCGTTCGAAGCAGGCCGTCAAGCCCGTCGTGCCT
CTGCCCTACATTAAACGTCAGCCGGCTCCTGTGGCTGTTATTTCGCCGCCTATCTGCCATGGGACGGGAGTGGCC
ACCAATGGTCACGGTGAGCTAACCCTCGCTCGTCTGCACTGATGGATTTCCATGTACTAACTCGGCTTCAAAAGT
TGATGATGCGTCTCCCATCACCCCTGCCGATGTTTCCGAACCGTCGCCTTCCATAGTCTCCAACGGAGGAGTCTT
TGCTCCGCATGAGCCCGGACTCGAGACTGGTGTGTTGAAGAGCCTCCTCGTCCGGGTTGGGCGCCGACTGACAGC
GTAAAGCAGCCAACAACGGGCTCGCCAAGGCTCATGAGCCACCCTTTCTCCCTCAGGCCGCTTCGCCCACGCATA
ACCATGTGCCGGCGCTCTTTGCCCGGCCGATGCCCATTATGGCCAACGGAGACATGCCTCGAGGGCCTCCCCCCT
CCCGCCCAACGGACCGCATCCAGTACACCAGCAGCATCCGAGCAACGGTAGCATCTACTTTGGAACTCTCGACGA
CTCCCAGGGCTCGTCTCCTGCGCCGCCACCCTCGGGGGGCATTCCTCCGCCGCCAGGCATGGCAGGCCCCGAAGG
TCGACCGCCCTACTTGGGCCCTGCTGGCAACGGCTTTGCGCCCATGATGCCCTTTCCCGGCGAAGTCATGCCCAT
GAACAACGTGGACAGTTTTGGCCGTCCGACCGCTGGCTACGGCCATGGCGATCCCTTTCCTGCCTACGGCGCAAA
CTACGGCCCTTCGACACCTCGCAGTTTCCACGATTCGCAGTCGTCTGGTCATCCCGATGACGGAGCCATGTTTGG
CCACTATTCGCATCGCAACGGAGGACCCATCATGGGCGACGACATCAACACCCAGCGACGCATGTTAGGTCCCCT
GGGACTGTTCCCTGGCTTGGGCATCCCGCCCCCGATGCCGCCCGGCAACTTGGAGAATGGTCTGATTGGATATCT
GCAGCAGCAGTTCGCCCGTCCCGAATCCGCCGATTGTACCCTGGAGCTTCGATATCCCGCCGACAGGGCGCCGCC
TGTGCGCATCCCCGCCCACCGCCTTATTCTCTGTCGCAGTGCCGATCTCGCCATCAGGCTTCAGCAGACAGCCTC
GGACGCCGCCGCTCCACCAACCGTCGTCGTTGAAGGCTGTGGCCGGTGGATGCGGTCCGACGCCTTCTACACGGC
TGCTCAGTCATTATACGGCCTCCCGCTCCTGCAGATGCCGCTGCATGGTCGTGCGGATCCGGGTGACGTGATGGA
GGCCGGACCGGTCAAAGAGCAGCTCGACTTCTGCCTGAGCTACGCCGCGGCCGGCTACCTCATCGGCTGGTGGCC
CGTCACGAGACGTGGCTGCGAAGTGGCGATGCAACTACTGGGCTGGCCTACGCTGGAGACGACTGTCGATTTCGC
ACTCGACGGTTTCGTCGACATGGGCTCGCACGATGTGTACAAGCTCGGGGAGGGGTCGCGGACCTTGCTCATGGC
CGTCATCAGCTTCATCGTGCATAACCTCCCGCCGACCTTTAGCATCGACACGACTGTCGAGGACTCTGAAAGCTA
CCATCGACTTCCGGTCCGACTTCCGGCACCGGCCTCGTCTGCAAATACTGTCGAGGCCAGCCCGCCTGCGATGAC
GACGAGGGTGCCGTCGGTGCAGTTCGGCAAGGGTCGTCGGCCGCAGCAGATTTCCCACATTCAATTCGGGGATCT
CTCCATGTCCGAGTCGGAAACGCCCAAGGCGACGCGGATTCCTCAGCCGGCATCGCACGCGATCCTATCGCGCGT
CCTTCTCAACCTTCCATTTTCGCAACTGAAGATGCTCGTCGAGTTGCCGCCCTCATCAGCCAACCTACACGGCTG
GGTGGCAATGGCCCACACCGTCAAGGCGGCGGTCGTTGAGCGCGAGGTTCGACGCCAGAAGTCGGTCGAGGCCGT
CATCGACGGGCGAGTCACCGTCTCGGATGCGGTCAAGGCGGCGCTGCGCAGCCCGACTCCACAGGATGCAGGGCA
ATGGAGCCTCCTGGGCTGGCAGGAGGAGATGATGTTGTCGGTCAGTCCGGAGGAAACGTCGCTCATTCGGAAATG
GGTGCCGCTGATGGACGCGCACAATGGAGTGACAGCCGAATACCCATGAAGACACCTGGCCTGACGATGTGATGC
ATGTTCCGTGCGAGTCGCATTTTGCTTTTTGAGGTACAATATGTTTGGTGGATGAAAGTGATCCCCATTCTCCTT
CTGTTTTTTTTTTCCTTCTCCTCTTCTTATTTATTCCCCTTTTGACCGCCTTTTGTTTTTCTTTCTATTTTTCCT
AAAAGCAGGCGGAATGAGGCTCTGCAACGAGGTACGGTGAGAAGGCCGATGCAGGCCCAATGTGAATAACGATGG
ACTGGAGGACGGCAGCGTCCGGGGTGGAGAGGGGGTTCCGAGGACCACGTGGCTGGTCCGAGCCGGATAGAGAGC
TGGATGGAGATTTGAGCAACGATGGCCGGCCTGATGAGGGTAGGATATGGCTAGATAGGAATCGGAATTGAGGAT
TGTCGTCGGCAGCGCTAGCCGCGCTGGTAGCTGGATGTATGTATGTGCACGTGTAAGAGACGCGATAGACGCGCC
TCATCCATGGATAAGTAGGTACCTACCTGGCAGGGCCATCCTTGGACGAGTTTTTTAGTGCCTTTAGGCCTTGGT
AGCGGCGGGCATCGCTGCAGCGACCACCTGGCCAGGCGCCTTACGTAATTGGGTTGCATCACAACAGCTCAAGCC
GAGGTTCGTGACAGGGACTCCCCCTTGTTGTGAATTTGTCATGGACTCGGGATAGCCTCTCGCGCTTCTGAGGCC
ACTCGTCAGCGCACTATATACCCTCACTCGCATCCTCGAGTACGATCCCTCAGCAGCAGCCAGCGGCAGCCGTCA
TGTCATCACCGGACCCGGCAGCGGCACCCTCGTCGGCGTCCCCCGCACCGCGAAGAAGCCCCAGCAGCTCGTCCT
CACCATCGGCCAGCGTGGACCCGGTACTGCGCAACGCACTGAGATACACCGTCTCGGCGCGAGAGTACGCTCTCC
TCCATCGGCATGTGCTCTCGCGGGCGCGGGCGGTGCGTCGAAACGTGCCGGGTCCGGCCAGCGTCGAGCGGGCGC
TGGCGCCGAAGCAGGGCCACGGAATCGGCCACGATTATAATGCCAAGGCTGTGCGGCATGCCTTGCGAGTGTTTT
CTGCTTCTTGGTTGGGGCTGAGGGGGTATGAGGCCGTGGTGAAGAGGATTGGGGCAAGGGGGTAGGTGTCTGTCT
ATTGTCTTTTCCCTTTTCTCCCGTCTTATATATGCGTACTTACCATGGGTCTGGTCCAGAAAGCGCTCAGCCTCA
AAGACGCCGGCGGTGCGGCTCTCGCTCTCGCTCTCGGCGGTGCTGCTCATATACCGTCTCCTGTACCGGTTCTTA
TCACGGCTGCGAGCTCAACTGCTTCACTCGCAGGCTGAGCCCTTCCGGAAGCGCAACCCTCGGGTGGCAGCGGCC
CTGACGTCGACCTATGCGCCGGCTGTTGGCGCATCGTTGGCCGGGCTCGCCCTGGGAGGGTGTCCGGCGCAGCAG
TTGCGCGTCTCCATCGCGCTGTGGGCTCTCTTCCGCGCCCTCGAGTTTGGTTGGAACTCGTGCGAGGCTGATGGG
CTCGTGTGGGGGTCGAAGAACGGGAAGAAGAGGGAGCGGCCTTGGTGGTTTGGGAGCTGGTTGTTGCAACCGTTT
TCGTTTGGCCAGCTGCTGCACGCCTGCGTCTTCGACCGAGATTGCTTCCCCGAGGTGGGCTCTGTTCGCCTGCTT
CTCATGACAAGCGTGAGACTGACTGCCCCTTAGACGTACGGCAGCTTCATCTTCAAGCAGTCGCCCGTCTACTTG
CACCAACGACCGAAAGACTGGCCCTCACACAGGCTGTGGCCGGACGCGCCGCAGATTGTCACCAGCCTGGCCGAG
ATGGCGCGGCTGAACTGGCCGTACGTCTTCCAGCGTCTCCGTCCGAGAGAAGAAGACTGACGGCGACTCCAAGGG
CCTACATCTCGCCGACTCTGTTCCCGCAAAAGGAGAGCCTCCCCCCCTCGCTACAGACGGTGGCGCCCCTGACAT
GGCGCGCCCACCCGCTGTTGTCGTCGCTATCGTGCGCGACGCTACACCCGTCAGACCCGTCGTGTCTGCGAACGT
ACCTCACCTTTTGGCTCGACTCGTTCCCGCCGATGGCGCGCTTCTTCCTGGCGCTGTGCTCGGCGCTGACGTTGC
TGTCGCGAGCGCGGGCCTTTCACGACCGGCCGCTGGCTACGACACAGCGCATCGTGGCGCGAGCGTTGGGCATGT
CGACGTTCGCGACGGGCGCCATCTCGACGGCCTGGGCGTCGATATGCCTGTTCCAGACCTGGCTTCCACGCCACG
TGCTGGCAACGCGGCGATTCTTCCTCGGCGGCTTCCTGGCAGGTCTCTGGGCGTGGGTCGAGCGCCGACACGGCC
GAAGCGTCTTCCTGTACAGCGCCAGGGCGAGCGTCGACTCGCTGTGGAAGGTGGGCGTCAAGCGTCGGTGGTGGC
GGGCCATGCGCGGAGGAGACGTCTGGGTGTTTGCCCTGGCGCTCATGCTCACGGGCGTGGTGTACGAGCGTGATG
CCAGGGCTATCCGCGAGGCGCGCTGGCGGAAGGGCGTGAGTTGGCTTAGGGGGGAGGGGTGGAGGGATTGGGCGG
GGAGGATGGGGATGAGGAGGTGGGGAGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail