Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01067
Gene name
Locationscaffold_01:3971316..3972778
Strand+
Gene length (bp)1462
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20510 HgmA_N Homogentisate 1,2-dioxygenase N-terminal 1.7E-92 13 244
PF20510 HgmA_N Homogentisate 1,2-dioxygenase N-terminal 4.5E-11 270 309
PF04209 HgmA_C Homogentisate 1,2-dioxygenase C-terminal 9.3E-67 311 462

GO

GO Term Description Terminal node
GO:0006570 tyrosine metabolic process Yes
GO:0006559 L-phenylalanine catabolic process Yes
GO:0004411 homogentisate 1,2-dioxygenase activity Yes
GO:0046395 carboxylic acid catabolic process No
GO:0016054 organic acid catabolic process No
GO:0044281 small molecule metabolic process No
GO:0009063 cellular amino acid catabolic process No
GO:0003824 catalytic activity No
GO:0006520 cellular amino acid metabolic process No
GO:0044282 small molecule catabolic process No
GO:0016491 oxidoreductase activity No
GO:1901565 organonitrogen compound catabolic process No
GO:0009074 aromatic amino acid family catabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1902222 erythrose 4-phosphate/phosphoenolpyruvate family amino acid catabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0009056 catabolic process No
GO:0009987 cellular process No
GO:0043436 oxoacid metabolic process No
GO:0044237 cellular metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:1901606 alpha-amino acid catabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0008150 biological_process No
GO:0006082 organic acid metabolic process No
GO:1901575 organic substance catabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:1902221 erythrose 4-phosphate/phosphoenolpyruvate family amino acid metabolic process No
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen No
GO:1901360 organic cyclic compound metabolic process No
GO:0044248 cellular catabolic process No
GO:0006558 L-phenylalanine metabolic process No
GO:0003674 molecular_function No
GO:0009072 aromatic amino acid family metabolic process No
GO:0051213 dioxygenase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus|Lysosome/Vacuole 0.4286 0.5995 0.0851 0.1893 0.0429 0.0484 0.1605 0.676 0.0825 0.1343

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup289
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4119
Ophiocordyceps australis map64 (Brazil) OphauB2|7549
Ophiocordyceps camponoti-floridani Ophcf2|01067 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06912
Ophiocordyceps camponoti-rufipedis Ophun1|1380
Ophiocordyceps camponoti-rufipedis Ophun1|6684
Ophiocordyceps kimflemingae Ophio5|5969
Ophiocordyceps kimflemingae Ophio5|8546
Ophiocordyceps subramaniannii Hirsu2|598
Ophiocordyceps subramaniannii Hirsu2|9804

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01067
MPVTEFDIEERYRYMNGFGSHFETSAIEGALPIGQNSPQRPAHGLYAEKLSGTSFTAPRHSNQQTWLYRKLPSCS
HPAYQPCGGDDDEAKHMHYLPNQLRWDPFDHDEARHLDFVAGLKRVGGAGDAALKQGFGLFVYAAGRSMDRRGAF
YSADGDLLIVAQEGALDIRTELGWLLVRPMEVCVLPRGVRYRVRLVDGRPVRGYALELYQGHFTLPELGPIGSNG
LANSRDFQAPVASFDDDDDDDDDDDDDDDDGYEHGFESDVESSALNSYAITVKFNHTLFTTRQPNSPFDVVAWQG
NYYPYKYDLGRFNTMGTVSFDHPDPSIFTVLTAQPHASPGTAVADLVVFPPRWLVAEDTFRPPWYHRNTMSEFMG
LIRGAYDAKPPGKGGFAPGGASLHNVMSAHGPDAESFERARGAGLVPDKVGEGSCAFMFESCLMVGVSEWGLRTC
KKVQEGYSEETWGG*
Coding >Ophcf2|01067
ATGCCTGTGACCGAGTTCGATATCGAGGAGCGGTATCGCTATATGAATGGCTTCGGGAGTCACTTCGAGACATCA
GCCATCGAGGGCGCGCTGCCCATCGGACAAAACTCCCCCCAGCGACCGGCCCACGGCCTCTACGCCGAGAAGCTC
TCCGGCACGTCATTCACGGCGCCGCGGCACAGCAACCAGCAGACGTGGCTGTACCGCAAGCTGCCCAGCTGCTCG
CATCCAGCCTACCAGCCTTGCGGAGGCGACGACGACGAGGCGAAGCACATGCACTACCTGCCCAACCAGCTGCGA
TGGGACCCCTTTGACCACGACGAGGCCCGTCACCTGGACTTCGTCGCCGGGTTGAAGCGCGTGGGCGGCGCGGGA
GATGCCGCTCTCAAGCAAGGCTTCGGCCTCTTCGTCTACGCCGCCGGACGGAGCATGGATCGTCGAGGCGCGTTT
TACTCTGCCGATGGGGATCTGCTCATCGTTGCTCAGGAGGGGGCGCTGGATATCAGGACGGAACTCGGCTGGCTG
CTCGTTCGGCCCATGGAGGTGTGTGTCTTGCCGAGGGGGGTGCGTTACCGGGTCAGGTTGGTGGATGGGAGGCCG
GTAAGGGGGTATGCGCTCGAGTTGTATCAGGGGCATTTCACCTTGCCTGAGTTGGGGCCCATCGGATCGAATGGG
TTGGCGAACTCGCGGGATTTTCAAGCGCCGGTCGCTTCGTTTGATGACGATGACGATGACGATGACGATGACGAT
GACGATGACGATGACGGTTATGAACATGGTTTCGAGTCCGACGTCGAGTCCTCGGCTCTCAACTCGTACGCCATC
ACCGTCAAGTTCAACCACACCCTCTTCACGACCCGACAACCCAACTCACCCTTCGACGTCGTCGCCTGGCAGGGA
AACTATTACCCCTACAAGTACGACCTCGGCCGCTTCAACACCATGGGGACCGTCTCCTTCGACCATCCCGACCCG
TCCATCTTCACCGTCCTGACAGCCCAGCCCCACGCCTCGCCCGGCACCGCCGTCGCCGACCTCGTCGTCTTCCCT
CCCCGCTGGCTGGTGGCGGAAGACACCTTCCGACCGCCCTGGTACCACCGCAACACCATGAGCGAGTTCATGGGC
CTCATCCGCGGGGCTTACGATGCGAAGCCGCCGGGGAAGGGGGGCTTCGCTCCCGGGGGCGCGAGTCTTCACAAC
GTCATGTCGGCGCACGGGCCCGACGCCGAGAGCTTCGAGAGGGCGCGAGGGGCGGGACTCGTGCCGGATAAGGTC
GGGGAGGGGAGCTGTGCTTTCATGTTCGAGAGCTGTCTCATGGTCGGCGTCTCCGAGTGGGGGCTTCGTACTTGT
AAGAAGGTCCAGGAGGGATACAGCGAGGAGACGTGGGGGGGGTGA
Transcript >Ophcf2|01067
ATGCCTGTGACCGAGTTCGATATCGAGGAGCGGTATCGCTATATGAATGGCTTCGGGAGTCACTTCGAGACATCA
GCCATCGAGGGCGCGCTGCCCATCGGACAAAACTCCCCCCAGCGACCGGCCCACGGCCTCTACGCCGAGAAGCTC
TCCGGCACGTCATTCACGGCGCCGCGGCACAGCAACCAGCAGACGTGGCTGTACCGCAAGCTGCCCAGCTGCTCG
CATCCAGCCTACCAGCCTTGCGGAGGCGACGACGACGAGGCGAAGCACATGCACTACCTGCCCAACCAGCTGCGA
TGGGACCCCTTTGACCACGACGAGGCCCGTCACCTGGACTTCGTCGCCGGGTTGAAGCGCGTGGGCGGCGCGGGA
GATGCCGCTCTCAAGCAAGGCTTCGGCCTCTTCGTCTACGCCGCCGGACGGAGCATGGATCGTCGAGGCGCGTTT
TACTCTGCCGATGGGGATCTGCTCATCGTTGCTCAGGAGGGGGCGCTGGATATCAGGACGGAACTCGGCTGGCTG
CTCGTTCGGCCCATGGAGGTGTGTGTCTTGCCGAGGGGGGTGCGTTACCGGGTCAGGTTGGTGGATGGGAGGCCG
GTAAGGGGGTATGCGCTCGAGTTGTATCAGGGGCATTTCACCTTGCCTGAGTTGGGGCCCATCGGATCGAATGGG
TTGGCGAACTCGCGGGATTTTCAAGCGCCGGTCGCTTCGTTTGATGACGATGACGATGACGATGACGATGACGAT
GACGATGACGATGACGGTTATGAACATGGTTTCGAGTCCGACGTCGAGTCCTCGGCTCTCAACTCGTACGCCATC
ACCGTCAAGTTCAACCACACCCTCTTCACGACCCGACAACCCAACTCACCCTTCGACGTCGTCGCCTGGCAGGGA
AACTATTACCCCTACAAGTACGACCTCGGCCGCTTCAACACCATGGGGACCGTCTCCTTCGACCATCCCGACCCG
TCCATCTTCACCGTCCTGACAGCCCAGCCCCACGCCTCGCCCGGCACCGCCGTCGCCGACCTCGTCGTCTTCCCT
CCCCGCTGGCTGGTGGCGGAAGACACCTTCCGACCGCCCTGGTACCACCGCAACACCATGAGCGAGTTCATGGGC
CTCATCCGCGGGGCTTACGATGCGAAGCCGCCGGGGAAGGGGGGCTTCGCTCCCGGGGGCGCGAGTCTTCACAAC
GTCATGTCGGCGCACGGGCCCGACGCCGAGAGCTTCGAGAGGGCGCGAGGGGCGGGACTCGTGCCGGATAAGGTC
GGGGAGGGGAGCTGTGCTTTCATGTTCGAGAGCTGTCTCATGGTCGGCGTCTCCGAGTGGGGGCTTCGTACTTGT
AAGAAGGTCCAGGAGGGATACAGCGAGGAGACGTGGGGGGGGTGA
Gene >Ophcf2|01067
ATGCCTGTGACCGAGTTCGATATCGAGGAGCGGTATCGCTATATGAATGGCTTCGGGAGTCACTTCGAGTTGAGA
ATCCCCTGCTCACTCTAGGTGCCTTCCATCCCATATCCGGAACATGCTGACTCTTCCCAGGACATCAGCCATCGA
GGGCGCGCTGCCCATCGGACAAAACTCCCCCCAGCGACCGGCCCACGGCCTCTACGCCGAGAAGCTCTCCGGCAC
GTCATTCACGGCGCCGCGGCACAGCAACCAGCAGACGTGGCTGTACCGCAAGCTGCCCAGCTGCTCGCATCCAGC
CTACCAGCCTTGCGGAGGCGACGACGACGAGGCGAAGCACATGCACTACCTGCCCAACCAGCTGCGATGGGACCC
CTTTGACCACGACGAGGCCCGTCACCTGGACTTCGTCGCCGGGTTGAAGCGCGTGGGCGGCGCGGGAGATGCCGC
TCTCAAGCAAGGCTTCGGCCTCTTCGTCTACGCCGCCGGACGGAGCATGGATCGTCGAGGCGCGTTTTACTCTGC
CGATGGGGATCTGCTCATCGTTGCTCAGGAGGGGGCGCTGGATATCAGGACGGAACTCGGCTGGCTGCTCGTTCG
GCCCATGGAGGTGTGTGTCTTGCCGAGGGGGGTGCGTTACCGGGTCAGGTTGGTGGATGGGAGGCCGGTAAGGGG
GTATGCGCTCGAGTTGTATCAGGGGCATTTCACCTTGCCTGAGTTGGGGCCCATCGGATCGAATGGGTTGGCGAA
CTCGCGGGATTTTCAAGCGCCGGTCGCTTCGTTTGATGACGATGACGATGACGATGACGATGACGATGACGATGA
CGATGACGGTTATGAACATGGTTTCGAGTCCGACGTCGAGTCCTCGGCTCTCAACTCGTACGCCATCACCGTCAA
GTTCAACCACACCCTCTTCACGACCCGACAACCCAACTCACCCTTCGACGTCGTCGCCTGGCAGGGAAACTATTA
CCCCTACAAGTACGACCTCGGCCGCTTCAACACCATGGGGACCGTCTCCTTCGACCATCCCGACCCGTCCATCTT
CACCGTCCTGACAGCCCAGCCCCACGCCTCGCCCGGCACCGCCGTCGCCGACCTCGTCGTCTTCCCTCCCCGCTG
GCTGGTGGCGGAAGACACCTTCCGACCGCCCTGGTACCACCGCAACACCATGAGCGAGTTCATGGGCCTCATCCG
CGGGGCTTACGATGCGAAGCCGCCGGGGAAGGGGGGCTTCGCTCCCGGGGGCGCGAGTCTTCACAACGTCATGTC
GGCGCACGGGCCCGACGCCGAGAGCTTCGAGAGGGCGCGAGGGGCGGGACTCGTGCCGGATAAGGTCGGGGAGGG
GAGCTGTGCTTTCATGTTCGAGAGCTGTCTCATGGTCGGCGTCTCCGAGTGGGGGCTTCGTACTTGTAAGAAGGT
CCAGGAGGGATACAGCGAGGAGACGTGGGGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail