Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01065
Gene name
Locationscaffold_01:3964609..3965854
Strand-
Gene length (bp)1245
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09362 DUF1996 Domain of unknown function (DUF1996) 1.2E-69 35 266

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0999 0.1054 0.9553 0.1229 0.0811 0.028 0.1258 0.1384 0.0595 0.0105

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6062
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01065 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6682
Ophiocordyceps kimflemingae Ophio5|3618
Ophiocordyceps subramaniannii Hirsu2|2323

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01065
MKLDKCAALAPFFLPNALGHIFTVNCKALTIQRGDPIVFPGIPSPHVHTVVGGTAFALTESNDDAKASKATTCDK
VLDNSNYWQPQLYHQRRDGKFELVEMQGIAAYYIDRACDYAAGRRKCDNTPHCRAPPAGLRMVVGNPYLRTYDAS
NPEQRAISHVCLGPGTSNDTAHLPTKQCERLRAETFFPSCWDGVNLDSANHKSHMAFPAIGDYNTGVCPPSHPIA
ILSVFLEFFYDTAAIRDFNRWVWSMGDPTGYGLHGDFINGWTDQAALERAMDTCTGSSGVDDARCSLNVGSGGPG
QPSLQSPQIRPPEEDVGLRGPLDRLPGDNPVTGLVVGGRNGTRFRA*
Coding >Ophcf2|01065
ATGAAGCTCGACAAGTGTGCCGCTCTGGCCCCCTTCTTCTTGCCCAACGCCCTCGGCCACATCTTTACCGTCAAC
TGCAAGGCCCTGACGATCCAGCGCGGAGACCCCATCGTCTTCCCCGGCATTCCATCTCCGCACGTCCACACCGTG
GTCGGAGGCACCGCCTTTGCCCTGACGGAAAGCAACGACGATGCCAAGGCCTCCAAGGCGACAACCTGTGACAAG
GTCCTGGACAATAGCAACTACTGGCAGCCTCAGCTCTACCATCAACGGCGCGATGGGAAGTTTGAGCTGGTAGAG
ATGCAGGGGATCGCGGCCTATTACATTGATAGAGCCTGTGATTATGCTGCGGGCCGTAGAAAGTGCGATAACACG
CCGCATTGTCGAGCACCGCCTGCAGGACTTCGGATGGTTGTAGGGAATCCATATCTTCGAACCTACGACGCTTCC
AACCCGGAGCAACGAGCCATCTCTCACGTCTGCTTGGGCCCGGGAACGTCGAATGATACGGCTCACCTGCCGACG
AAGCAGTGCGAGCGTCTCCGAGCCGAGACCTTTTTCCCCTCGTGCTGGGATGGAGTCAACTTGGACAGCGCGAAT
CATAAGAGCCATATGGCATTCCCAGCCATCGGCGACTACAACACAGGCGTCTGTCCTCCCTCCCATCCCATAGCC
ATCCTCTCCGTCTTCCTCGAGTTCTTCTACGACACGGCGGCCATCCGGGACTTCAACCGCTGGGTATGGTCCATG
GGCGACCCGACCGGCTACGGCCTCCACGGCGACTTCATCAACGGATGGACCGATCAAGCAGCCCTGGAGCGGGCC
ATGGACACATGCACCGGCTCGTCGGGCGTCGACGATGCCCGTTGTAGCCTGAACGTCGGATCAGGCGGACCCGGA
CAGCCGAGCCTGCAATCGCCGCAGATCAGGCCGCCCGAGGAAGATGTAGGCCTCCGGGGGCCCCTGGATAGGCTG
CCTGGAGACAATCCCGTCACGGGCTTGGTGGTTGGGGGGCGGAACGGGACGAGATTCCGGGCATGA
Transcript >Ophcf2|01065
ATGAAGCTCGACAAGTGTGCCGCTCTGGCCCCCTTCTTCTTGCCCAACGCCCTCGGCCACATCTTTACCGTCAAC
TGCAAGGCCCTGACGATCCAGCGCGGAGACCCCATCGTCTTCCCCGGCATTCCATCTCCGCACGTCCACACCGTG
GTCGGAGGCACCGCCTTTGCCCTGACGGAAAGCAACGACGATGCCAAGGCCTCCAAGGCGACAACCTGTGACAAG
GTCCTGGACAATAGCAACTACTGGCAGCCTCAGCTCTACCATCAACGGCGCGATGGGAAGTTTGAGCTGGTAGAG
ATGCAGGGGATCGCGGCCTATTACATTGATAGAGCCTGTGATTATGCTGCGGGCCGTAGAAAGTGCGATAACACG
CCGCATTGTCGAGCACCGCCTGCAGGACTTCGGATGGTTGTAGGGAATCCATATCTTCGAACCTACGACGCTTCC
AACCCGGAGCAACGAGCCATCTCTCACGTCTGCTTGGGCCCGGGAACGTCGAATGATACGGCTCACCTGCCGACG
AAGCAGTGCGAGCGTCTCCGAGCCGAGACCTTTTTCCCCTCGTGCTGGGATGGAGTCAACTTGGACAGCGCGAAT
CATAAGAGCCATATGGCATTCCCAGCCATCGGCGACTACAACACAGGCGTCTGTCCTCCCTCCCATCCCATAGCC
ATCCTCTCCGTCTTCCTCGAGTTCTTCTACGACACGGCGGCCATCCGGGACTTCAACCGCTGGGTATGGTCCATG
GGCGACCCGACCGGCTACGGCCTCCACGGCGACTTCATCAACGGATGGACCGATCAAGCAGCCCTGGAGCGGGCC
ATGGACACATGCACCGGCTCGTCGGGCGTCGACGATGCCCGTTGTAGCCTGAACGTCGGATCAGGCGGACCCGGA
CAGCCGAGCCTGCAATCGCCGCAGATCAGGCCGCCCGAGGAAGATGTAGGCCTCCGGGGGCCCCTGGATAGGCTG
CCTGGAGACAATCCCGTCACGGGCTTGGTGGTTGGGGGGCGGAACGGGACGAGATTCCGGGCATGA
Gene >Ophcf2|01065
ATGAAGCTCGACAAGTGTGCCGCTCTGGCCCCCTTCTTCTTGCCCAACGCCCTCGGCCACATCTTTACCGTCAAC
TGCAAGGCCCTGACGATCCAGCGCGGAGACCCCATCGTCTTCCCCGGCATTCCATCTCCGCACGTCCACACCGTG
GTCGGAGGCACCGCCTTTGCCCTGACGGAAAGCAACGACGATGCCAAGGCCTCCAAGGCGACAACCTGTGACAAG
GTCCTGGACAATAGCAACTACTGGCAGCCTCAGCTCTACCATCAACGGCGCGATGGGAAGTTTGAGCTGGTAGAG
ATGCAGGGGATCGTGAGTCTGGGTCTCGGTCCGCCGCTGTTGGGGGAGGGAGGGACTGACGAGGCTGCATCACAG
GCGGCCTATTACATTGATAGAGCCTGTGATTATGCTGCGGGCCGTAGAAAGTGCGATAACACGCCGCATTGTCGA
GCACCGCCTGCAGGACTTCGGATGGTTGTAGGGAATCCATATCTTCGGTCAGTCATGAGACCTCGTCGGCTTCGA
AGACGGTTCCGAACTGACAGCAAAAGAACCTACGACGCTTCCAACCCGGAGCAACGAGCCATCTCTCACGTCTGC
TTGGGCCCGGGAACGTCGAATGATACGGCTCACCTGCCGACGAAGCAGTGCGAGCGTCTCCGAGCCGAGACCTTT
TTCCCCTCGTGCTGGGATGGAGTCAACTTGGACAGCGCGAATCATAAGAGCCATGTGAGTAGATTGAAGATGAAT
CTCAGGTTACATGACATGTAGATGAGATGGGCTGCTGATATCAAGGCTTCAATCAATCTCGTCTAGATGGCATTC
CCAGCCATCGGCGACTACAACACAGGCGTCTGTCCTCCCTCCCATCCCATAGCCATCCTCTCCGTCTTCCTCGAG
TTCTTCTACGACACGGCGGCCATCCGGGACTTCAACCGCTGGGTATGGTCCATGGGCGACCCGACCGGCTACGGC
CTCCACGGCGACTTCATCAACGGATGGACCGATCAAGCAGCCCTGGAGCGGGCCATGGACACATGCACCGGCTCG
TCGGGCGTCGACGATGCCCGTTGTAGCCTGAACGTCGGATCAGGCGGACCCGGACAGCCGAGCCTGCAATCGCCG
CAGATCAGGCCGCCCGAGGAAGATGTAGGCCTCCGGGGGCCCCTGGATAGGCTGCCTGGAGACAATCCCGTCACG
GGCTTGGTGGTTGGGGGGCGGAACGGGACGAGATTCCGGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail