Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01059
Gene name
Locationscaffold_01:3953850..3955163
Strand+
Gene length (bp)1313
Transcript length (bp)963
Coding sequence length (bp)963
Protein length (aa) 321

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09084 NMT1 NMT1/THI5 like 6.0E-09 16 47
PF09084 NMT1 NMT1/THI5 like 2.2E-45 47 215

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6938 0.4691 0.0833 0.175 0.2205 0.0701 0.032 0.1284 0.0977 0.1386

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1.29 0.00 2.58
Alive In ants, during behavior modification 190.89 71.45 310.33
Dead In ants, recently dead 58.90 27.37 90.43

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000238 yes
Dead Fungus 0.000238 yes

Orthologs

Orthofinder run ID4
Orthogroup2040
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6835
Ophiocordyceps australis map64 (Brazil) OphauB2|4525
Ophiocordyceps camponoti-floridani Ophcf2|01059 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6676
Ophiocordyceps kimflemingae Ophio5|5405
Ophiocordyceps subramaniannii Hirsu2|2328

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01059
MSTEKITFLTNWHATAYHAPLYLAQAKGFFRDEGIQVAILEPNDPSAKARRFPILSIGSLLDEPFTGLIHLTGSG
IDDTLASLAGKRIGYVGEFGKLQMDDLMSRHGLSPDDYTAVRCGMKVSNALISGDIDAGIGLDNIQMVELEDWLA
SCGRHRSEAKMLRIDELAELGCCCFCSVLYIGNENFVARNPDRVRSFMRAVKRATDLVLADPQAAWEQYVAFKPV
MAGHLHRTMFERSFAFFSPDLKNVPRDWAKVTSYGRRLGLLGQDFTPNYTNDFLAWTLEPDSRDPVGDQRRMAEL
QRDVACRGGFRRLPAPVVSV*
Coding >Ophcf2|01059
ATGTCGACGGAGAAGATTACCTTTTTGACCAACTGGCATGCGACTGCCTACCACGCGCCGCTCTACCTGGCACAG
GCCAAGGGCTTCTTCCGCGACGAAGGCATCCAAGTGGCCATTCTCGAACCCAACGATCCGAGCGCCAAAGCCCGC
CGCTTCCCCATCCTCTCCATCGGCAGCCTCCTAGACGAGCCCTTCACAGGCCTGATCCACCTCACGGGCTCCGGA
ATCGACGACACGCTCGCCTCCCTGGCAGGCAAACGCATCGGCTACGTCGGCGAATTCGGCAAGCTACAGATGGAC
GACCTCATGTCACGTCACGGCCTCTCTCCCGACGATTACACGGCCGTCCGGTGCGGCATGAAGGTCTCAAACGCC
CTCATCTCGGGCGATATCGACGCCGGCATCGGCCTCGATAACATCCAGATGGTCGAGCTCGAAGACTGGCTCGCG
TCGTGTGGTAGGCATCGGTCTGAGGCGAAGATGCTTCGTATCGACGAACTAGCCGAGCTCGGATGCTGCTGCTTC
TGCTCCGTCCTCTACATCGGCAACGAGAACTTCGTGGCCCGGAACCCGGACCGGGTTCGGAGCTTCATGCGGGCC
GTCAAGCGAGCCACCGATCTGGTCCTGGCCGATCCCCAGGCAGCATGGGAGCAATACGTGGCCTTCAAACCCGTC
ATGGCCGGCCATCTTCACCGGACCATGTTCGAACGCAGCTTCGCCTTCTTCTCACCCGATCTCAAGAACGTTCCA
CGCGACTGGGCCAAGGTGACGAGCTACGGTCGACGTCTCGGCCTTCTCGGTCAGGACTTTACCCCCAACTACACA
AACGACTTCCTCGCCTGGACGCTCGAGCCCGATTCCCGCGACCCCGTCGGAGATCAGAGGCGGATGGCTGAGCTG
CAGAGGGACGTTGCCTGCCGAGGAGGCTTCCGCAGGCTCCCTGCTCCCGTCGTCAGTGTGTAG
Transcript >Ophcf2|01059
ATGTCGACGGAGAAGATTACCTTTTTGACCAACTGGCATGCGACTGCCTACCACGCGCCGCTCTACCTGGCACAG
GCCAAGGGCTTCTTCCGCGACGAAGGCATCCAAGTGGCCATTCTCGAACCCAACGATCCGAGCGCCAAAGCCCGC
CGCTTCCCCATCCTCTCCATCGGCAGCCTCCTAGACGAGCCCTTCACAGGCCTGATCCACCTCACGGGCTCCGGA
ATCGACGACACGCTCGCCTCCCTGGCAGGCAAACGCATCGGCTACGTCGGCGAATTCGGCAAGCTACAGATGGAC
GACCTCATGTCACGTCACGGCCTCTCTCCCGACGATTACACGGCCGTCCGGTGCGGCATGAAGGTCTCAAACGCC
CTCATCTCGGGCGATATCGACGCCGGCATCGGCCTCGATAACATCCAGATGGTCGAGCTCGAAGACTGGCTCGCG
TCGTGTGGTAGGCATCGGTCTGAGGCGAAGATGCTTCGTATCGACGAACTAGCCGAGCTCGGATGCTGCTGCTTC
TGCTCCGTCCTCTACATCGGCAACGAGAACTTCGTGGCCCGGAACCCGGACCGGGTTCGGAGCTTCATGCGGGCC
GTCAAGCGAGCCACCGATCTGGTCCTGGCCGATCCCCAGGCAGCATGGGAGCAATACGTGGCCTTCAAACCCGTC
ATGGCCGGCCATCTTCACCGGACCATGTTCGAACGCAGCTTCGCCTTCTTCTCACCCGATCTCAAGAACGTTCCA
CGCGACTGGGCCAAGGTGACGAGCTACGGTCGACGTCTCGGCCTTCTCGGTCAGGACTTTACCCCCAACTACACA
AACGACTTCCTCGCCTGGACGCTCGAGCCCGATTCCCGCGACCCCGTCGGAGATCAGAGGCGGATGGCTGAGCTG
CAGAGGGACGTTGCCTGCCGAGGAGGCTTCCGCAGGCTCCCTGCTCCCGTCGTCAGTGTGTAG
Gene >Ophcf2|01059
ATGTCGACGGAGAAGATTACCTTTTTGACCAACTGGTGAGCGGTCACATGTTCACGCTCTTCAAAGACTCTCCTC
TTCAAAGACTCTCCTCCCCATCGACAGTACGCGACACTTGAGCAGATCAGTTGCTGAACCGCATCCAAGGCATGC
GACTGCCTACCACGCGCCGCTCTACCTGGCACAGGCCAAGGGCTTCTTCCGCGACGAAGGCATCCAAGTGGCCAT
TCTCGAACCCAACGATCCGAGCGTACGTTCCGTCATGCCACATACGTCTTCAACAACATACATACTCATCAAGAT
TGGTAAAAGGACGTAACCGAGATCATCGGCAGCGGCAAAGCAGACCTCGGCTTCAAAGCCATGATTCACACCCTG
GCAGTTACGCTCCCCCTCTTCCAACCCTTTCAACCCTTTCAACCCTTTCAACCCTTTCAACCCTTCCAACCCTTC
CAACCCCAACTTCAACCTACCTAACATGACCCGTCCAGGCCAAAGCCCGCCGCTTCCCCATCCTCTCCATCGGCA
GCCTCCTAGACGAGCCCTTCACAGGCCTGATCCACCTCACGGGCTCCGGAATCGACGACACGCTCGCCTCCCTGG
CAGGCAAACGCATCGGCTACGTCGGCGAATTCGGCAAGCTACAGATGGACGACCTCATGTCACGTCACGGCCTCT
CTCCCGACGATTACACGGCCGTCCGGTGCGGCATGAAGGTCTCAAACGCCCTCATCTCGGGCGATATCGACGCCG
GCATCGGCCTCGATAACATCCAGATGGTCGAGCTCGAAGACTGGCTCGCGTCGTGTGGTAGGCATCGGTCTGAGG
CGAAGATGCTTCGTATCGACGAACTAGCCGAGCTCGGATGCTGCTGCTTCTGCTCCGTCCTCTACATCGGCAACG
AGAACTTCGTGGCCCGGAACCCGGACCGGGTTCGGAGCTTCATGCGGGCCGTCAAGCGAGCCACCGATCTGGTCC
TGGCCGATCCCCAGGCAGCATGGGAGCAATACGTGGCCTTCAAACCCGTCATGGCCGGCCATCTTCACCGGACCA
TGTTCGAACGCAGCTTCGCCTTCTTCTCACCCGATCTCAAGAACGTTCCACGCGACTGGGCCAAGGTGACGAGCT
ACGGTCGACGTCTCGGCCTTCTCGGTCAGGACTTTACCCCCAACTACACAAACGACTTCCTCGCCTGGACGCTCG
AGCCCGATTCCCGCGACCCCGTCGGAGATCAGAGGCGGATGGCTGAGCTGCAGAGGGACGTTGCCTGCCGAGGAG
GCTTCCGCAGGCTCCCTGCTCCCGTCGTCAGTGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail