Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01058
Gene name
Locationscaffold_01:3948907..3952986
Strand+
Gene length (bp)4079
Transcript length (bp)3321
Coding sequence length (bp)3321
Protein length (aa) 1107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 6.6E-38 212 410
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.5E-35 889 1091
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 3.9E-12 427 714
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.1E-07 777 820
PF13246 Cation_ATPase Cation transport ATPase (P-type) 4.8E-15 483 594
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 4.6E-10 95 162

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 143 165 22
2 175 197 22
3 338 360 22
4 380 402 22
5 864 886 22
6 891 913 22
7 934 956 22
8 996 1015 19
9 1036 1058 22
10 1063 1085 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.19 0.00 0.40
Alive In ants, during behavior modification 2.26 0.73 3.78
Dead In ants, recently dead 1.59 0.36 2.81

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.213451 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01058
MTTDKAAADRIRWGDVEQGRSRSRHRSSRPLSRTNSVESLAIRSIHSRGQVDPALTLPIQYRTVSFQIEESRGKE
RVELVRAADTAAKDLGHLEWHTLPARDVAQRLLTSPREGLSEEQGRRRLTEYGRNAPSPPKTNRLLAMFGYFFKG
FGGILLIGSVLVFVSWKPLGNPPALANLALAVVLLAVFFIQAGFAMFQDWSTSRVMASIKDMLPEHCQVTRDGQL
VQLPAEVLVPGDVVSIKAGNKLPADVRFITMSSDAKFDRSVLTGESRPVAATVDHTDDNYLETLNIGLQGTHCIV
GSGIGIVVATGDGTVFGRIASLTNEPKGKMTTLEREVLYFVLFICAIMFTMIALVLILWGAWLRRDHPNWIDVPT
LIVDCVSVAVAFIPEGLPIAITAGLTITANMMRKHKVLCKSLKTVETLGSVSVICSDKTGTLTQGKMSLTDCSIG
AANTTVQALHDEISQPKQASSLTPFLQLGALAALCNAAEMDVAQSDVPLDQRAVFGDATDTAILRFSESLAENNV
GFYRSSWQRVFELAFNSKNKFMIRCFALTRRDALGSTLDRASADGFAEGDLLLTIKGAPDVLLGRCSHYVSPSGD
LVPLDAEAAANLERIKDIYSSQGKRCLLIARKTVPAATVAAGPEPGTAKYEAAMTDEARAGLTLVGLVAIVDPLR
PEIREVVSTLRGAGVRIAMVTGDFALTALAIAREAGIVTSPQVDTAENLDTTPRLPDSGSGSEDADEKKGGTTVI
TGRDALVISGPQLTRLSDGQWRLLTEYDEIVFARTTPEQKLRIVREFQRESVVAMTGDGVNDAPSLKAADVGIAL
GSGSDIAMEAADMILLESFSSVVVAVQYGRVVFDNLKKVIAYLLPAGSFSEFWPVMTSVIFGLPQILSSFLMIII
CCFTDCAAATILSFEKPEADVLTRPPRNVKKDRLVNWQLVLHAYGIVGMTETIASFAMSFWYLQRNGIAFRDLWF
SFGQLPPGIEKPYYDQKLAEASSIYFVNLVVMQWFNLMATRTRRLSIFQHPPMFNKETQNLYLFPSILFALGMAL
LWIYPPSIQSVLGTASIPVEYWFLPFSFGLFIILLDEARRYWVRRRPDSWVARAAW*
Coding >Ophcf2|01058
ATGACGACCGACAAGGCGGCAGCGGATCGGATCCGTTGGGGTGACGTCGAGCAAGGCCGTTCACGGTCTCGTCAC
CGGTCGTCGAGGCCGTTGAGCCGGACCAACTCGGTCGAGTCGCTGGCCATCCGGAGCATCCATTCCCGCGGCCAG
GTCGATCCGGCCTTGACACTTCCGATCCAGTACCGGACCGTCTCCTTTCAGATCGAAGAGTCCAGGGGTAAAGAA
CGCGTTGAACTCGTCCGGGCCGCTGACACGGCGGCCAAAGACCTCGGCCATCTGGAATGGCACACGCTCCCTGCC
CGTGATGTTGCTCAGCGGCTGTTGACTTCGCCGCGGGAAGGCCTCTCGGAGGAGCAGGGCCGGCGTCGATTGACC
GAGTATGGACGGAACGCGCCGTCTCCGCCCAAGACGAACCGGTTGTTGGCCATGTTTGGATACTTCTTCAAGGGC
TTCGGTGGGATCCTTCTGATTGGTAGCGTGTTGGTGTTTGTGTCGTGGAAGCCGTTGGGGAACCCGCCGGCTCTG
GCTAACCTGGCCCTCGCCGTCGTCCTCCTCGCCGTCTTCTTCATCCAAGCCGGATTCGCCATGTTCCAAGACTGG
TCGACATCTCGCGTCATGGCCTCGATCAAGGATATGCTCCCCGAACACTGCCAGGTGACTCGAGACGGCCAGCTC
GTCCAGCTCCCCGCAGAAGTCCTCGTCCCCGGAGACGTCGTCTCCATCAAAGCCGGAAACAAACTCCCCGCTGAC
GTCCGCTTCATCACCATGTCCTCTGACGCAAAGTTCGACCGGTCCGTCTTGACCGGCGAGTCGCGTCCCGTGGCC
GCCACCGTCGATCACACCGACGACAACTATCTCGAGACGCTCAATATAGGCCTTCAGGGGACTCACTGCATCGTC
GGTTCGGGCATTGGCATCGTCGTCGCTACCGGGGATGGCACCGTCTTTGGTAGGATAGCTTCTCTGACCAACGAG
CCCAAGGGTAAGATGACGACGCTGGAAAGAGAGGTGCTTTACTTTGTCCTCTTCATCTGCGCCATCATGTTCACC
ATGATTGCCCTCGTCTTGATACTCTGGGGAGCCTGGCTTCGACGAGATCATCCCAACTGGATCGATGTACCGACC
CTCATCGTCGATTGCGTCAGTGTTGCCGTCGCCTTCATCCCCGAAGGCCTTCCCATTGCCATCACGGCTGGACTC
ACCATCACGGCAAACATGATGCGGAAGCACAAGGTGCTGTGCAAGTCGCTCAAGACGGTCGAGACTCTGGGCTCC
GTGTCCGTCATCTGCTCGGACAAGACGGGAACTCTTACGCAGGGCAAAATGTCCCTCACAGATTGCTCCATCGGC
GCCGCCAACACCACCGTCCAAGCCCTCCACGACGAAATCTCCCAGCCCAAACAAGCCTCCTCGCTAACCCCCTTC
CTCCAGCTCGGCGCCCTGGCCGCCCTCTGCAACGCGGCCGAGATGGACGTCGCCCAGTCCGACGTCCCCCTCGAT
CAGCGAGCCGTCTTCGGAGACGCCACCGACACCGCCATCCTGCGCTTCTCCGAGTCTCTGGCCGAGAACAACGTT
GGCTTCTACCGCTCGAGCTGGCAGCGTGTCTTTGAGCTTGCCTTTAACAGCAAGAATAAGTTTATGATTCGTTGC
TTTGCCTTGACGAGGAGGGATGCCCTGGGATCGACTCTGGATCGTGCTTCGGCAGATGGCTTTGCCGAGGGAGAC
TTACTGTTGACCATAAAGGGCGCTCCTGATGTCCTCCTCGGCCGCTGCTCCCACTACGTCTCCCCCTCGGGCGAC
CTTGTCCCTCTCGATGCCGAAGCGGCCGCCAACCTGGAGCGTATCAAGGACATCTACTCCTCCCAGGGCAAGCGA
TGTCTCCTCATAGCCCGCAAGACAGTCCCCGCCGCCACCGTGGCCGCCGGTCCGGAACCCGGGACGGCAAAGTAC
GAGGCGGCCATGACGGACGAGGCCAGGGCCGGACTGACGCTGGTTGGATTGGTGGCCATTGTTGATCCGCTTCGG
CCTGAGATCCGAGAGGTGGTTTCTACGCTGCGAGGTGCGGGTGTGAGGATTGCCATGGTCACCGGCGACTTCGCC
CTCACAGCCCTCGCCATCGCCCGCGAAGCCGGCATCGTAACCAGCCCCCAAGTCGACACAGCCGAGAACCTCGAC
ACAACGCCCCGCCTCCCAGACTCTGGCTCAGGCTCGGAAGACGCAGACGAGAAGAAAGGCGGCACGACCGTCATC
ACCGGCCGCGACGCCCTCGTCATCAGCGGCCCCCAACTCACCCGTCTCAGCGACGGTCAGTGGCGTCTCCTCACC
GAGTACGACGAGATCGTCTTCGCCCGCACGACGCCGGAGCAGAAGCTGCGCATCGTTCGAGAGTTTCAGCGTGAG
AGCGTCGTGGCCATGACGGGTGATGGCGTGAATGACGCGCCTTCTCTCAAGGCTGCTGACGTTGGTATCGCCCTG
GGCAGCGGATCTGATATCGCCATGGAGGCTGCGGATATGATTCTGCTCGAGTCGTTTTCCTCCGTTGTCGTGGCT
GTGCAATACGGCCGTGTTGTCTTTGACAATCTCAAAAAGGTCATCGCCTATCTACTACCGGCCGGCAGTTTCTCC
GAGTTCTGGCCCGTCATGACATCCGTCATCTTTGGCCTGCCGCAGATTCTGTCGTCGTTTCTCATGATTATCATC
TGCTGCTTCACCGACTGCGCCGCCGCAACGATCCTCTCCTTCGAAAAGCCCGAAGCCGACGTCCTCACCCGCCCC
CCCCGCAACGTCAAGAAGGACAGGCTCGTCAACTGGCAGCTTGTCCTACACGCCTACGGCATCGTCGGCATGACC
GAGACAATCGCCTCCTTCGCCATGTCCTTCTGGTACCTGCAACGCAACGGCATCGCCTTCCGAGACCTGTGGTTC
AGCTTCGGCCAGCTGCCTCCCGGCATTGAGAAGCCCTACTACGATCAGAAGCTGGCCGAGGCGTCGTCCATCTAC
TTCGTCAACCTCGTCGTCATGCAGTGGTTCAACCTCATGGCTACCCGAACCCGACGGCTTTCCATCTTCCAGCAT
CCGCCCATGTTCAATAAGGAGACGCAGAATCTGTACCTCTTCCCGTCCATTCTGTTTGCCCTGGGCATGGCCCTG
CTTTGGATCTACCCGCCTTCCATTCAGAGCGTCCTGGGAACGGCCAGCATCCCCGTCGAATACTGGTTCCTCCCC
TTTAGCTTCGGTCTGTTCATCATCCTGCTGGACGAGGCGAGGAGATATTGGGTCCGGAGACGGCCCGACAGCTGG
GTGGCGAGGGCTGCATGGTGA
Transcript >Ophcf2|01058
ATGACGACCGACAAGGCGGCAGCGGATCGGATCCGTTGGGGTGACGTCGAGCAAGGCCGTTCACGGTCTCGTCAC
CGGTCGTCGAGGCCGTTGAGCCGGACCAACTCGGTCGAGTCGCTGGCCATCCGGAGCATCCATTCCCGCGGCCAG
GTCGATCCGGCCTTGACACTTCCGATCCAGTACCGGACCGTCTCCTTTCAGATCGAAGAGTCCAGGGGTAAAGAA
CGCGTTGAACTCGTCCGGGCCGCTGACACGGCGGCCAAAGACCTCGGCCATCTGGAATGGCACACGCTCCCTGCC
CGTGATGTTGCTCAGCGGCTGTTGACTTCGCCGCGGGAAGGCCTCTCGGAGGAGCAGGGCCGGCGTCGATTGACC
GAGTATGGACGGAACGCGCCGTCTCCGCCCAAGACGAACCGGTTGTTGGCCATGTTTGGATACTTCTTCAAGGGC
TTCGGTGGGATCCTTCTGATTGGTAGCGTGTTGGTGTTTGTGTCGTGGAAGCCGTTGGGGAACCCGCCGGCTCTG
GCTAACCTGGCCCTCGCCGTCGTCCTCCTCGCCGTCTTCTTCATCCAAGCCGGATTCGCCATGTTCCAAGACTGG
TCGACATCTCGCGTCATGGCCTCGATCAAGGATATGCTCCCCGAACACTGCCAGGTGACTCGAGACGGCCAGCTC
GTCCAGCTCCCCGCAGAAGTCCTCGTCCCCGGAGACGTCGTCTCCATCAAAGCCGGAAACAAACTCCCCGCTGAC
GTCCGCTTCATCACCATGTCCTCTGACGCAAAGTTCGACCGGTCCGTCTTGACCGGCGAGTCGCGTCCCGTGGCC
GCCACCGTCGATCACACCGACGACAACTATCTCGAGACGCTCAATATAGGCCTTCAGGGGACTCACTGCATCGTC
GGTTCGGGCATTGGCATCGTCGTCGCTACCGGGGATGGCACCGTCTTTGGTAGGATAGCTTCTCTGACCAACGAG
CCCAAGGGTAAGATGACGACGCTGGAAAGAGAGGTGCTTTACTTTGTCCTCTTCATCTGCGCCATCATGTTCACC
ATGATTGCCCTCGTCTTGATACTCTGGGGAGCCTGGCTTCGACGAGATCATCCCAACTGGATCGATGTACCGACC
CTCATCGTCGATTGCGTCAGTGTTGCCGTCGCCTTCATCCCCGAAGGCCTTCCCATTGCCATCACGGCTGGACTC
ACCATCACGGCAAACATGATGCGGAAGCACAAGGTGCTGTGCAAGTCGCTCAAGACGGTCGAGACTCTGGGCTCC
GTGTCCGTCATCTGCTCGGACAAGACGGGAACTCTTACGCAGGGCAAAATGTCCCTCACAGATTGCTCCATCGGC
GCCGCCAACACCACCGTCCAAGCCCTCCACGACGAAATCTCCCAGCCCAAACAAGCCTCCTCGCTAACCCCCTTC
CTCCAGCTCGGCGCCCTGGCCGCCCTCTGCAACGCGGCCGAGATGGACGTCGCCCAGTCCGACGTCCCCCTCGAT
CAGCGAGCCGTCTTCGGAGACGCCACCGACACCGCCATCCTGCGCTTCTCCGAGTCTCTGGCCGAGAACAACGTT
GGCTTCTACCGCTCGAGCTGGCAGCGTGTCTTTGAGCTTGCCTTTAACAGCAAGAATAAGTTTATGATTCGTTGC
TTTGCCTTGACGAGGAGGGATGCCCTGGGATCGACTCTGGATCGTGCTTCGGCAGATGGCTTTGCCGAGGGAGAC
TTACTGTTGACCATAAAGGGCGCTCCTGATGTCCTCCTCGGCCGCTGCTCCCACTACGTCTCCCCCTCGGGCGAC
CTTGTCCCTCTCGATGCCGAAGCGGCCGCCAACCTGGAGCGTATCAAGGACATCTACTCCTCCCAGGGCAAGCGA
TGTCTCCTCATAGCCCGCAAGACAGTCCCCGCCGCCACCGTGGCCGCCGGTCCGGAACCCGGGACGGCAAAGTAC
GAGGCGGCCATGACGGACGAGGCCAGGGCCGGACTGACGCTGGTTGGATTGGTGGCCATTGTTGATCCGCTTCGG
CCTGAGATCCGAGAGGTGGTTTCTACGCTGCGAGGTGCGGGTGTGAGGATTGCCATGGTCACCGGCGACTTCGCC
CTCACAGCCCTCGCCATCGCCCGCGAAGCCGGCATCGTAACCAGCCCCCAAGTCGACACAGCCGAGAACCTCGAC
ACAACGCCCCGCCTCCCAGACTCTGGCTCAGGCTCGGAAGACGCAGACGAGAAGAAAGGCGGCACGACCGTCATC
ACCGGCCGCGACGCCCTCGTCATCAGCGGCCCCCAACTCACCCGTCTCAGCGACGGTCAGTGGCGTCTCCTCACC
GAGTACGACGAGATCGTCTTCGCCCGCACGACGCCGGAGCAGAAGCTGCGCATCGTTCGAGAGTTTCAGCGTGAG
AGCGTCGTGGCCATGACGGGTGATGGCGTGAATGACGCGCCTTCTCTCAAGGCTGCTGACGTTGGTATCGCCCTG
GGCAGCGGATCTGATATCGCCATGGAGGCTGCGGATATGATTCTGCTCGAGTCGTTTTCCTCCGTTGTCGTGGCT
GTGCAATACGGCCGTGTTGTCTTTGACAATCTCAAAAAGGTCATCGCCTATCTACTACCGGCCGGCAGTTTCTCC
GAGTTCTGGCCCGTCATGACATCCGTCATCTTTGGCCTGCCGCAGATTCTGTCGTCGTTTCTCATGATTATCATC
TGCTGCTTCACCGACTGCGCCGCCGCAACGATCCTCTCCTTCGAAAAGCCCGAAGCCGACGTCCTCACCCGCCCC
CCCCGCAACGTCAAGAAGGACAGGCTCGTCAACTGGCAGCTTGTCCTACACGCCTACGGCATCGTCGGCATGACC
GAGACAATCGCCTCCTTCGCCATGTCCTTCTGGTACCTGCAACGCAACGGCATCGCCTTCCGAGACCTGTGGTTC
AGCTTCGGCCAGCTGCCTCCCGGCATTGAGAAGCCCTACTACGATCAGAAGCTGGCCGAGGCGTCGTCCATCTAC
TTCGTCAACCTCGTCGTCATGCAGTGGTTCAACCTCATGGCTACCCGAACCCGACGGCTTTCCATCTTCCAGCAT
CCGCCCATGTTCAATAAGGAGACGCAGAATCTGTACCTCTTCCCGTCCATTCTGTTTGCCCTGGGCATGGCCCTG
CTTTGGATCTACCCGCCTTCCATTCAGAGCGTCCTGGGAACGGCCAGCATCCCCGTCGAATACTGGTTCCTCCCC
TTTAGCTTCGGTCTGTTCATCATCCTGCTGGACGAGGCGAGGAGATATTGGGTCCGGAGACGGCCCGACAGCTGG
GTGGCGAGGGCTGCATGGTGA
Gene >Ophcf2|01058
ATGACGACCGACAAGGCGGCAGCGGATCGGATCCGTTGGGGTGACGTCGAGCAAGGCCGTTCACGGTCTCGTCAC
CGGTCGTCGAGGCCGTTGAGCCGGACCAACTCGGTCGAGTCGCTGGCCATCCGGAGCATCCATTCCCGCGGCCAG
GTCGATCCGGCCTTGACACTTCCGATCCAGTACCGGACCGTGTAAGCCGTTCCGTAACGTGTCTGTCTACGAATA
GAGAGCCGGCATCAGTCTGATAGCCTCCGCAGCTCCTTTCAGATCGAAGAGTCCAGGGGTAAAGAACGCGTTGAA
CTCGTCCGGGCCGCTGACACGGCGGCCAAAGACCTCGGCCATCTGGAATGGCACACGCTCCCTGCCCGTGATGTT
GCTCAGCGGCTGTTGACTTCGCCGCGGGAAGGCCTCTCGGAGGAGCAGGGCCGGCGTCGATTGACCGAGTATGGA
CGGAACGCGCCGTCTCCGCCCAAGACGAACCGGTTGTTGGCCATGTTTGGATACTTCTTCAAGGGCTTCGGTGGG
ATCCTTCTGATTGGTAGCGTGTTGGTGTTTGTGTCGTGGAAGCCGTTGGGGAACCCGCCGGCTCTGGCTAACCTG
GTGAACATGATCCATCACCTTTTCTTTTCTCCTCTTGATGATGCCGAAGCTGATGGGGTACGAAACATGTCTCTA
GGCCCTCGCCGTCGTCCTCCTCGCCGTCTTCTTCATCCAAGCCGGATTCGCCATGTTCCAAGACTGGTCGACATC
TCGCGTCATGGCCTCGATCAAGGATATGCTCCCCGAACACTGCCAGGTGACTCGAGACGGCCAGCTCGTCCAGCT
CCCCGCAGAAGTCCTCGTCCCCGGAGACGTCGTCTCCATCAAAGCCGGAAACAAACTCCCCGCTGACGTCCGCTT
CATCACCATGTCCTCTGACGCAAAGTTCGACCGGTCCGTCTTGACCGGCGAGTCGCGTCCCGTGGCCGCCACCGT
CGATCACACCGACGACAACTATCTCGAGACGCTCAATATAGGCCTTCAGGGGACTCACTGCATCGTCGGTTCGGG
CATTGGCATCGTCGTCGCTACCGGGGATGGCACCGTCTTTGGTAGGATAGCTTCTCTGACCAACGAGCCCAAGGG
TAAGATGACGACGCTGGAAAGAGAGGTGCTTTACTTTGTCCTCTTCATCTGCGCCATCATGTTCACCATGATTGC
CCTCGTCTTGATACTCTGGGGAGCCTGGCTTCGACGAGATCATCCCAACTGGATCGATGTACCGACCCTCATCGT
CGATTGCGTCAGTGTTGCCGTCGCCTTCATCCCCGAAGGCCTTCCCATTGCCATCACGGCTGGACTCACCATCAC
GGCAAACATGATGCGGAAGCACAAGGTGCTGTGCAAGTCGCTCAAGACGGTCGAGACTCTGGGCTCCGTGTCCGT
CATCTGCTCGGACAAGACGGGAACTCTTACGCAGGTAAGCCCCTGAGCCCCTATTCTCCATGTACATACATACAC
AGTCGACCCCGGTCACCACGACCCCCTTCACCATCAAGACTCGTCCCATATACTAACATTGACCATCCAGGGCAA
AATGTCCCTCACAGATTGCTCCATCGGCGCCGCCAACACCACCGTCCAAGCCCTCCACGACGAAATCTCCCAGCC
CAAACAAGCCTCCTCGCTAACCCCCTTCCTCCAGCTCGGCGCCCTGGCCGCCCTCTGCAACGCGGCCGAGATGGA
CGTCGCCCAGTCCGACGTCCCCCTCGATCAGCGAGCCGTCTTCGGAGACGCCACCGACACCGCCATCCTGCGCTT
CTCCGAGTCTCTGGCCGAGAACAACGTTGGCTTCTACCGCTCGAGCTGGCAGCGTGTCTTTGAGCTTGCCTTTAA
CAGCAAGAATAAGTTTATGATTCGTTGCTTTGCCTTGACGAGGAGGGATGCCCTGGGATCGACTCTGGATCGTGC
TTCGGCAGATGGCTTTGCCGAGGGAGACTTGTAAAGTGCCCTTGCTTGACCAGCACTTTACACACTACAATCTGG
GGCTTACACGTTCAAACAGACTGTTGACCATAAAGGGCGCTCCTGATGTCCTCCTCGGCCGCTGCTCCCACTACG
TCTCCCCCTCGGGCGACCTTGTCCCTCTCGATGCCGAAGCGGCCGCCAACCTGGAGCGTATCAAGGACATCTACT
CCTCCCAGGGCAAGCGATGTCTCCTCATAGCCCGCAAGACAGTCCCCGCCGCCACCGTGGCCGCCGGTCCGGAAC
CCGGGACGGCAAAGTACGAGGCGGCCATGACGGACGAGGCCAGGGCCGGACTGACGCTGGTTGGATTGGTGGCCA
TTGTTGATCCGCTTCGGCCTGAGATCCGAGAGGTGGTTTCTACGCTGCGAGGTGCGGGTGTGAGGATTGCCATGG
TGAGTCCACATCGTTTCATATGAAGGGAGTCGAAGGGAGTTGAGGGGAGTTGAGGGGAGTTGAAGAGAGTTGAAG
AGAGTCGAAGAGAGTCGAAGAGAGTTGAAGAGAGTTGAAAAGAGTTGAAGAGAGTTGAAGAGAGTTGAAGAGAGT
TGAAGAGAGAGTTGAAGAGAGTTGAAGAGAGTTGAAGAGAGTTGAAGAGACAAGAGACAGAGACAAACAGGTCCT
AACAAAACACATCAAGGTCACCGGCGACTTCGCCCTCACAGCCCTCGCCATCGCCCGCGAAGCCGGCATCGTAAC
CAGCCCCCAAGTCGACACAGCCGAGAACCTCGACACAACGCCCCGCCTCCCAGACTCTGGCTCAGGCTCGGAAGA
CGCAGACGAGAAGAAAGGCGGCACGACCGTCATCACCGGCCGCGACGCCCTCGTCATCAGCGGCCCCCAACTCAC
CCGTCTCAGCGACGGTCAGTGGCGTCTCCTCACCGAGTACGACGAGATCGTCTTCGCCCGCACGACGCCGGAGCA
GAAGCTGCGCATCGTTCGAGAGTTTCAGCGTGAGAGCGTCGTGGCCATGACGGGTGATGGCGTGAATGACGCGCC
TTCTCTCAAGGCTGCTGACGTTGGTATCGCCCTGGGCAGCGGATCTGATATCGCCATGGAGGCTGCGGATATGAT
TCTGCTCGAGTCGTTTTCCTCCGTTGTCGTGGCTGTGCAATACGGCCGTGTTGTCTTTGACAATCTCAAAAAGGT
TGGTTGTGCTTGCGATTGATCTGTGCGGCGTGTGTTTGAGTTGAGTGTCTGTGGCTCACTCCATCGTCCCTCCCA
GGTCATCGCCTATCTACTACCGGCCGGCAGTTTCTCCGAGTTCTGGCCCGTCATGACATCCGTCATCTTTGGCCT
GCCGCAGATTCTGTCGTCGTTTCTCATGATTATCATCTGGTACGTTGAAAAGCAGCAACTCGCACTCGCTCACAA
CCCTTTCCCCCTTTCCCCCTTTCCCTATCCATCCCCTTCATCCCACTCTCCAACCCCCCCATCTCCTCTCAACTA
ACCAAACCAGCTGCTTCACCGACTGCGCCGCCGCAACGATCCTCTCCTTCGAAAAGCCCGAAGCCGACGTCCTCA
CCCGCCCCCCCCGCAACGTCAAGAAGGACAGGCTCGTCAACTGGCAGCTTGTCCTACACGCCTACGGCATCGTCG
GCATGACCGAGACAATCGCCTCCTTCGCCATGTCCTTCTGGTACCTGCAACGCAACGGCATCGCCTTCCGAGACC
TGTGGTTCAGCTTCGGCCAGCTGCCTCCCGGCATTGAGAAGCCCTACTACGATCAGAAGCTGGCCGAGGCGTCGT
CCATCTACTTCGTCAACCTCGTCGTCATGCAGTGGTTCAACCTCATGGCTACCCGAACCCGACGGCTTTCCATCT
TCCAGCATCCGCCCATGTTCAATAAGGAGACGCAGAATCTGTACCTCTTCCCGTCCATTCTGTTTGCCCTGGGCA
TGGCCCTGCTTTGGATCTACCCGCCTTCCATTCAGAGCGTCCTGGGAACGGCCAGCATCCCCGTCGAATACTGGT
TCCTCCCCTTTAGCTTCGGTCTGTTCATCATCCTGCTGGACGAGGCGAGGAGATATTGGGTCCGGAGACGGCCCG
ACAGCTGGGTGGCGAGGGCTGCATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail