Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01058
Gene name
Locationscaffold_01:3948907..3952986
Strand+
Gene length (bp)4079
Transcript length (bp)3321
Coding sequence length (bp)3321
Protein length (aa) 1107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 6.6E-38 212 410
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 1.5E-35 889 1091
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 3.9E-12 427 714
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.1E-07 777 820
PF13246 Cation_ATPase Cation transport ATPase (P-type) 4.8E-15 483 594
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 4.6E-10 95 162

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 143 165 22
2 175 197 22
3 338 360 22
4 380 402 22
5 864 886 22
6 891 913 22
7 934 956 22
8 996 1015 19
9 1036 1058 22
10 1063 1085 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01058
MTTDKAAADRIRWGDVEQGRSRSRHRSSRPLSRTNSVESLAIRSIHSRGQVDPALTLPIQYRTVSFQIEESRGKE
RVELVRAADTAAKDLGHLEWHTLPARDVAQRLLTSPREGLSEEQGRRRLTEYGRNAPSPPKTNRLLAMFGYFFKG
FGGILLIGSVLVFVSWKPLGNPPALANLALAVVLLAVFFIQAGFAMFQDWSTSRVMASIKDMLPEHCQVTRDGQL
VQLPAEVLVPGDVVSIKAGNKLPADVRFITMSSDAKFDRSVLTGESRPVAATVDHTDDNYLETLNIGLQGTHCIV
GSGIGIVVATGDGTVFGRIASLTNEPKGKMTTLEREVLYFVLFICAIMFTMIALVLILWGAWLRRDHPNWIDVPT
LIVDCVSVAVAFIPEGLPIAITAGLTITANMMRKHKVLCKSLKTVETLGSVSVICSDKTGTLTQGKMSLTDCSIG
AANTTVQALHDEISQPKQASSLTPFLQLGALAALCNAAEMDVAQSDVPLDQRAVFGDATDTAILRFSESLAENNV
GFYRSSWQRVFELAFNSKNKFMIRCFALTRRDALGSTLDRASADGFAEGDLLLTIKGAPDVLLGRCSHYVSPSGD
LVPLDAEAAANLERIKDIYSSQGKRCLLIARKTVPAATVAAGPEPGTAKYEAAMTDEARAGLTLVGLVAIVDPLR
PEIREVVSTLRGAGVRIAMVTGDFALTALAIAREAGIVTSPQVDTAENLDTTPRLPDSGSGSEDADEKKGGTTVI
TGRDALVISGPQLTRLSDGQWRLLTEYDEIVFARTTPEQKLRIVREFQRESVVAMTGDGVNDAPSLKAADVGIAL
GSGSDIAMEAADMILLESFSSVVVAVQYGRVVFDNLKKVIAYLLPAGSFSEFWPVMTSVIFGLPQILSSFLMIII
CCFTDCAAATILSFEKPEADVLTRPPRNVKKDRLVNWQLVLHAYGIVGMTETIASFAMSFWYLQRNGIAFRDLWF
SFGQLPPGIEKPYYDQKLAEASSIYFVNLVVMQWFNLMATRTRRLSIFQHPPMFNKETQNLYLFPSILFALGMAL
LWIYPPSIQSVLGTASIPVEYWFLPFSFGLFIILLDEARRYWVRRRPDSWVARAAW*
Coding >Ophcf2|01058
ATGACGACCGACAAGGCGGCAGCGGATCGGATCCGTTGGGGTGACGTCGAGCAAGGCCGTTCACGGTCTCGTCAC
CGGTCGTCGAGGCCGTTGAGCCGGACCAACTCGGTCGAGTCGCTGGCCATCCGGAGCATCCATTCCCGCGGCCAG
GTCGATCCGGCCTTGACACTTCCGATCCAGTACCGGACCGTCTCCTTTCAGATCGAAGAGTCCAGGGGTAAAGAA
CGCGTTGAACTCGTCCGGGCCGCTGACACGGCGGCCAAAGACCTCGGCCATCTGGAATGGCACACGCTCCCTGCC
CGTGATGTTGCTCAGCGGCTGTTGACTTCGCCGCGGGAAGGCCTCTCGGAGGAGCAGGGCCGGCGTCGATTGACC
GAGTATGGACGGAACGCGCCGTCTCCGCCCAAGACGAACCGGTTGTTGGCCATGTTTGGATACTTCTTCAAGGGC
TTCGGTGGGATCCTTCTGATTGGTAGCGTGTTGGTGTTTGTGTCGTGGAAGCCGTTGGGGAACCCGCCGGCTCTG
GCTAACCTGGCCCTCGCCGTCGTCCTCCTCGCCGTCTTCTTCATCCAAGCCGGATTCGCCATGTTCCAAGACTGG
TCGACATCTCGCGTCATGGCCTCGATCAAGGATATGCTCCCCGAACACTGCCAGGTGACTCGAGACGGCCAGCTC
GTCCAGCTCCCCGCAGAAGTCCTCGTCCCCGGAGACGTCGTCTCCATCAAAGCCGGAAACAAACTCCCCGCTGAC
GTCCGCTTCATCACCATGTCCTCTGACGCAAAGTTCGACCGGTCCGTCTTGACCGGCGAGTCGCGTCCCGTGGCC
GCCACCGTCGATCACACCGACGACAACTATCTCGAGACGCTCAATATAGGCCTTCAGGGGACTCACTGCATCGTC
GGTTCGGGCATTGGCATCGTCGTCGCTACCGGGGATGGCACCGTCTTTGGTAGGATAGCTTCTCTGACCAACGAG
CCCAAGGGTAAGATGACGACGCTGGAAAGAGAGGTGCTTTACTTTGTCCTCTTCATCTGCGCCATCATGTTCACC
ATGATTGCCCTCGTCTTGATACTCTGGGGAGCCTGGCTTCGACGAGATCATCCCAACTGGATCGATGTACCGACC
CTCATCGTCGATTGCGTCAGTGTTGCCGTCGCCTTCATCCCCGAAGGCCTTCCCATTGCCATCACGGCTGGACTC
ACCATCACGGCAAACATGATGCGGAAGCACAAGGTGCTGTGCAAGTCGCTCAAGACGGTCGAGACTCTGGGCTCC
GTGTCCGTCATCTGCTCGGACAAGACGGGAACTCTTACGCAGGGCAAAATGTCCCTCACAGATTGCTCCATCGGC
GCCGCCAACACCACCGTCCAAGCCCTCCACGACGAAATCTCCCAGCCCAAACAAGCCTCCTCGCTAACCCCCTTC
CTCCAGCTCGGCGCCCTGGCCGCCCTCTGCAACGCGGCCGAGATGGACGTCGCCCAGTCCGACGTCCCCCTCGAT
CAGCGAGCCGTCTTCGGAGACGCCACCGACACCGCCATCCTGCGCTTCTCCGAGTCTCTGGCCGAGAACAACGTT
GGCTTCTACCGCTCGAGCTGGCAGCGTGTCTTTGAGCTTGCCTTTAACAGCAAGAATAAGTTTATGATTCGTTGC
TTTGCCTTGACGAGGAGGGATGCCCTGGGATCGACTCTGGATCGTGCTTCGGCAGATGGCTTTGCCGAGGGAGAC
TTACTGTTGACCATAAAGGGCGCTCCTGATGTCCTCCTCGGCCGCTGCTCCCACTACGTCTCCCCCTCGGGCGAC
CTTGTCCCTCTCGATGCCGAAGCGGCCGCCAACCTGGAGCGTATCAAGGACATCTACTCCTCCCAGGGCAAGCGA
TGTCTCCTCATAGCCCGCAAGACAGTCCCCGCCGCCACCGTGGCCGCCGGTCCGGAACCCGGGACGGCAAAGTAC
GAGGCGGCCATGACGGACGAGGCCAGGGCCGGACTGACGCTGGTTGGATTGGTGGCCATTGTTGATCCGCTTCGG
CCTGAGATCCGAGAGGTGGTTTCTACGCTGCGAGGTGCGGGTGTGAGGATTGCCATGGTCACCGGCGACTTCGCC
CTCACAGCCCTCGCCATCGCCCGCGAAGCCGGCATCGTAACCAGCCCCCAAGTCGACACAGCCGAGAACCTCGAC
ACAACGCCCCGCCTCCCAGACTCTGGCTCAGGCTCGGAAGACGCAGACGAGAAGAAAGGCGGCACGACCGTCATC
ACCGGCCGCGACGCCCTCGTCATCAGCGGCCCCCAACTCACCCGTCTCAGCGACGGTCAGTGGCGTCTCCTCACC
GAGTACGACGAGATCGTCTTCGCCCGCACGACGCCGGAGCAGAAGCTGCGCATCGTTCGAGAGTTTCAGCGTGAG
AGCGTCGTGGCCATGACGGGTGATGGCGTGAATGACGCGCCTTCTCTCAAGGCTGCTGACGTTGGTATCGCCCTG
GGCAGCGGATCTGATATCGCCATGGAGGCTGCGGATATGATTCTGCTCGAGTCGTTTTCCTCCGTTGTCGTGGCT
GTGCAATACGGCCGTGTTGTCTTTGACAATCTCAAAAAGGTCATCGCCTATCTACTACCGGCCGGCAGTTTCTCC
GAGTTCTGGCCCGTCATGACATCCGTCATCTTTGGCCTGCCGCAGATTCTGTCGTCGTTTCTCATGATTATCATC
TGCTGCTTCACCGACTGCGCCGCCGCAACGATCCTCTCCTTCGAAAAGCCCGAAGCCGACGTCCTCACCCGCCCC
CCCCGCAACGTCAAGAAGGACAGGCTCGTCAACTGGCAGCTTGTCCTACACGCCTACGGCATCGTCGGCATGACC
GAGACAATCGCCTCCTTCGCCATGTCCTTCTGGTACCTGCAACGCAACGGCATCGCCTTCCGAGACCTGTGGTTC
AGCTTCGGCCAGCTGCCTCCCGGCATTGAGAAGCCCTACTACGATCAGAAGCTGGCCGAGGCGTCGTCCATCTAC
TTCGTCAACCTCGTCGTCATGCAGTGGTTCAACCTCATGGCTACCCGAACCCGACGGCTTTCCATCTTCCAGCAT
CCGCCCATGTTCAATAAGGAGACGCAGAATCTGTACCTCTTCCCGTCCATTCTGTTTGCCCTGGGCATGGCCCTG
CTTTGGATCTACCCGCCTTCCATTCAGAGCGTCCTGGGAACGGCCAGCATCCCCGTCGAATACTGGTTCCTCCCC
TTTAGCTTCGGTCTGTTCATCATCCTGCTGGACGAGGCGAGGAGATATTGGGTCCGGAGACGGCCCGACAGCTGG
GTGGCGAGGGCTGCATGGTGA
Transcript >Ophcf2|01058
ATGACGACCGACAAGGCGGCAGCGGATCGGATCCGTTGGGGTGACGTCGAGCAAGGCCGTTCACGGTCTCGTCAC
CGGTCGTCGAGGCCGTTGAGCCGGACCAACTCGGTCGAGTCGCTGGCCATCCGGAGCATCCATTCCCGCGGCCAG
GTCGATCCGGCCTTGACACTTCCGATCCAGTACCGGACCGTCTCCTTTCAGATCGAAGAGTCCAGGGGTAAAGAA
CGCGTTGAACTCGTCCGGGCCGCTGACACGGCGGCCAAAGACCTCGGCCATCTGGAATGGCACACGCTCCCTGCC
CGTGATGTTGCTCAGCGGCTGTTGACTTCGCCGCGGGAAGGCCTCTCGGAGGAGCAGGGCCGGCGTCGATTGACC
GAGTATGGACGGAACGCGCCGTCTCCGCCCAAGACGAACCGGTTGTTGGCCATGTTTGGATACTTCTTCAAGGGC
TTCGGTGGGATCCTTCTGATTGGTAGCGTGTTGGTGTTTGTGTCGTGGAAGCCGTTGGGGAACCCGCCGGCTCTG
GCTAACCTGGCCCTCGCCGTCGTCCTCCTCGCCGTCTTCTTCATCCAAGCCGGATTCGCCATGTTCCAAGACTGG
TCGACATCTCGCGTCATGGCCTCGATCAAGGATATGCTCCCCGAACACTGCCAGGTGACTCGAGACGGCCAGCTC
GTCCAGCTCCCCGCAGAAGTCCTCGTCCCCGGAGACGTCGTCTCCATCAAAGCCGGAAACAAACTCCCCGCTGAC
GTCCGCTTCATCACCATGTCCTCTGACGCAAAGTTCGACCGGTCCGTCTTGACCGGCGAGTCGCGTCCCGTGGCC
GCCACCGTCGATCACACCGACGACAACTATCTCGAGACGCTCAATATAGGCCTTCAGGGGACTCACTGCATCGTC
GGTTCGGGCATTGGCATCGTCGTCGCTACCGGGGATGGCACCGTCTTTGGTAGGATAGCTTCTCTGACCAACGAG
CCCAAGGGTAAGATGACGACGCTGGAAAGAGAGGTGCTTTACTTTGTCCTCTTCATCTGCGCCATCATGTTCACC
ATGATTGCCCTCGTCTTGATACTCTGGGGAGCCTGGCTTCGACGAGATCATCCCAACTGGATCGATGTACCGACC
CTCATCGTCGATTGCGTCAGTGTTGCCGTCGCCTTCATCCCCGAAGGCCTTCCCATTGCCATCACGGCTGGACTC
ACCATCACGGCAAACATGATGCGGAAGCACAAGGTGCTGTGCAAGTCGCTCAAGACGGTCGAGACTCTGGGCTCC
GTGTCCGTCATCTGCTCGGACAAGACGGGAACTCTTACGCAGGGCAAAATGTCCCTCACAGATTGCTCCATCGGC
GCCGCCAACACCACCGTCCAAGCCCTCCACGACGAAATCTCCCAGCCCAAACAAGCCTCCTCGCTAACCCCCTTC
CTCCAGCTCGGCGCCCTGGCCGCCCTCTGCAACGCGGCCGAGATGGACGTCGCCCAGTCCGACGTCCCCCTCGAT
CAGCGAGCCGTCTTCGGAGACGCCACCGACACCGCCATCCTGCGCTTCTCCGAGTCTCTGGCCGAGAACAACGTT
GGCTTCTACCGCTCGAGCTGGCAGCGTGTCTTTGAGCTTGCCTTTAACAGCAAGAATAAGTTTATGATTCGTTGC
TTTGCCTTGACGAGGAGGGATGCCCTGGGATCGACTCTGGATCGTGCTTCGGCAGATGGCTTTGCCGAGGGAGAC
TTACTGTTGACCATAAAGGGCGCTCCTGATGTCCTCCTCGGCCGCTGCTCCCACTACGTCTCCCCCTCGGGCGAC
CTTGTCCCTCTCGATGCCGAAGCGGCCGCCAACCTGGAGCGTATCAAGGACATCTACTCCTCCCAGGGCAAGCGA
TGTCTCCTCATAGCCCGCAAGACAGTCCCCGCCGCCACCGTGGCCGCCGGTCCGGAACCCGGGACGGCAAAGTAC
GAGGCGGCCATGACGGACGAGGCCAGGGCCGGACTGACGCTGGTTGGATTGGTGGCCATTGTTGATCCGCTTCGG
CCTGAGATCCGAGAGGTGGTTTCTACGCTGCGAGGTGCGGGTGTGAGGATTGCCATGGTCACCGGCGACTTCGCC
CTCACAGCCCTCGCCATCGCCCGCGAAGCCGGCATCGTAACCAGCCCCCAAGTCGACACAGCCGAGAACCTCGAC
ACAACGCCCCGCCTCCCAGACTCTGGCTCAGGCTCGGAAGACGCAGACGAGAAGAAAGGCGGCACGACCGTCATC
ACCGGCCGCGACGCCCTCGTCATCAGCGGCCCCCAACTCACCCGTCTCAGCGACGGTCAGTGGCGTCTCCTCACC
GAGTACGACGAGATCGTCTTCGCCCGCACGACGCCGGAGCAGAAGCTGCGCATCGTTCGAGAGTTTCAGCGTGAG
AGCGTCGTGGCCATGACGGGTGATGGCGTGAATGACGCGCCTTCTCTCAAGGCTGCTGACGTTGGTATCGCCCTG
GGCAGCGGATCTGATATCGCCATGGAGGCTGCGGATATGATTCTGCTCGAGTCGTTTTCCTCCGTTGTCGTGGCT
GTGCAATACGGCCGTGTTGTCTTTGACAATCTCAAAAAGGTCATCGCCTATCTACTACCGGCCGGCAGTTTCTCC
GAGTTCTGGCCCGTCATGACATCCGTCATCTTTGGCCTGCCGCAGATTCTGTCGTCGTTTCTCATGATTATCATC
TGCTGCTTCACCGACTGCGCCGCCGCAACGATCCTCTCCTTCGAAAAGCCCGAAGCCGACGTCCTCACCCGCCCC
CCCCGCAACGTCAAGAAGGACAGGCTCGTCAACTGGCAGCTTGTCCTACACGCCTACGGCATCGTCGGCATGACC
GAGACAATCGCCTCCTTCGCCATGTCCTTCTGGTACCTGCAACGCAACGGCATCGCCTTCCGAGACCTGTGGTTC
AGCTTCGGCCAGCTGCCTCCCGGCATTGAGAAGCCCTACTACGATCAGAAGCTGGCCGAGGCGTCGTCCATCTAC
TTCGTCAACCTCGTCGTCATGCAGTGGTTCAACCTCATGGCTACCCGAACCCGACGGCTTTCCATCTTCCAGCAT
CCGCCCATGTTCAATAAGGAGACGCAGAATCTGTACCTCTTCCCGTCCATTCTGTTTGCCCTGGGCATGGCCCTG
CTTTGGATCTACCCGCCTTCCATTCAGAGCGTCCTGGGAACGGCCAGCATCCCCGTCGAATACTGGTTCCTCCCC
TTTAGCTTCGGTCTGTTCATCATCCTGCTGGACGAGGCGAGGAGATATTGGGTCCGGAGACGGCCCGACAGCTGG
GTGGCGAGGGCTGCATGGTGA
Gene >Ophcf2|01058
ATGACGACCGACAAGGCGGCAGCGGATCGGATCCGTTGGGGTGACGTCGAGCAAGGCCGTTCACGGTCTCGTCAC
CGGTCGTCGAGGCCGTTGAGCCGGACCAACTCGGTCGAGTCGCTGGCCATCCGGAGCATCCATTCCCGCGGCCAG
GTCGATCCGGCCTTGACACTTCCGATCCAGTACCGGACCGTGTAAGCCGTTCCGTAACGTGTCTGTCTACGAATA
GAGAGCCGGCATCAGTCTGATAGCCTCCGCAGCTCCTTTCAGATCGAAGAGTCCAGGGGTAAAGAACGCGTTGAA
CTCGTCCGGGCCGCTGACACGGCGGCCAAAGACCTCGGCCATCTGGAATGGCACACGCTCCCTGCCCGTGATGTT
GCTCAGCGGCTGTTGACTTCGCCGCGGGAAGGCCTCTCGGAGGAGCAGGGCCGGCGTCGATTGACCGAGTATGGA
CGGAACGCGCCGTCTCCGCCCAAGACGAACCGGTTGTTGGCCATGTTTGGATACTTCTTCAAGGGCTTCGGTGGG
ATCCTTCTGATTGGTAGCGTGTTGGTGTTTGTGTCGTGGAAGCCGTTGGGGAACCCGCCGGCTCTGGCTAACCTG
GTGAACATGATCCATCACCTTTTCTTTTCTCCTCTTGATGATGCCGAAGCTGATGGGGTACGAAACATGTCTCTA
GGCCCTCGCCGTCGTCCTCCTCGCCGTCTTCTTCATCCAAGCCGGATTCGCCATGTTCCAAGACTGGTCGACATC
TCGCGTCATGGCCTCGATCAAGGATATGCTCCCCGAACACTGCCAGGTGACTCGAGACGGCCAGCTCGTCCAGCT
CCCCGCAGAAGTCCTCGTCCCCGGAGACGTCGTCTCCATCAAAGCCGGAAACAAACTCCCCGCTGACGTCCGCTT
CATCACCATGTCCTCTGACGCAAAGTTCGACCGGTCCGTCTTGACCGGCGAGTCGCGTCCCGTGGCCGCCACCGT
CGATCACACCGACGACAACTATCTCGAGACGCTCAATATAGGCCTTCAGGGGACTCACTGCATCGTCGGTTCGGG
CATTGGCATCGTCGTCGCTACCGGGGATGGCACCGTCTTTGGTAGGATAGCTTCTCTGACCAACGAGCCCAAGGG
TAAGATGACGACGCTGGAAAGAGAGGTGCTTTACTTTGTCCTCTTCATCTGCGCCATCATGTTCACCATGATTGC
CCTCGTCTTGATACTCTGGGGAGCCTGGCTTCGACGAGATCATCCCAACTGGATCGATGTACCGACCCTCATCGT
CGATTGCGTCAGTGTTGCCGTCGCCTTCATCCCCGAAGGCCTTCCCATTGCCATCACGGCTGGACTCACCATCAC
GGCAAACATGATGCGGAAGCACAAGGTGCTGTGCAAGTCGCTCAAGACGGTCGAGACTCTGGGCTCCGTGTCCGT
CATCTGCTCGGACAAGACGGGAACTCTTACGCAGGTAAGCCCCTGAGCCCCTATTCTCCATGTACATACATACAC
AGTCGACCCCGGTCACCACGACCCCCTTCACCATCAAGACTCGTCCCATATACTAACATTGACCATCCAGGGCAA
AATGTCCCTCACAGATTGCTCCATCGGCGCCGCCAACACCACCGTCCAAGCCCTCCACGACGAAATCTCCCAGCC
CAAACAAGCCTCCTCGCTAACCCCCTTCCTCCAGCTCGGCGCCCTGGCCGCCCTCTGCAACGCGGCCGAGATGGA
CGTCGCCCAGTCCGACGTCCCCCTCGATCAGCGAGCCGTCTTCGGAGACGCCACCGACACCGCCATCCTGCGCTT
CTCCGAGTCTCTGGCCGAGAACAACGTTGGCTTCTACCGCTCGAGCTGGCAGCGTGTCTTTGAGCTTGCCTTTAA
CAGCAAGAATAAGTTTATGATTCGTTGCTTTGCCTTGACGAGGAGGGATGCCCTGGGATCGACTCTGGATCGTGC
TTCGGCAGATGGCTTTGCCGAGGGAGACTTGTAAAGTGCCCTTGCTTGACCAGCACTTTACACACTACAATCTGG
GGCTTACACGTTCAAACAGACTGTTGACCATAAAGGGCGCTCCTGATGTCCTCCTCGGCCGCTGCTCCCACTACG
TCTCCCCCTCGGGCGACCTTGTCCCTCTCGATGCCGAAGCGGCCGCCAACCTGGAGCGTATCAAGGACATCTACT
CCTCCCAGGGCAAGCGATGTCTCCTCATAGCCCGCAAGACAGTCCCCGCCGCCACCGTGGCCGCCGGTCCGGAAC
CCGGGACGGCAAAGTACGAGGCGGCCATGACGGACGAGGCCAGGGCCGGACTGACGCTGGTTGGATTGGTGGCCA
TTGTTGATCCGCTTCGGCCTGAGATCCGAGAGGTGGTTTCTACGCTGCGAGGTGCGGGTGTGAGGATTGCCATGG
TGAGTCCACATCGTTTCATATGAAGGGAGTCGAAGGGAGTTGAGGGGAGTTGAGGGGAGTTGAAGAGAGTTGAAG
AGAGTCGAAGAGAGTCGAAGAGAGTTGAAGAGAGTTGAAAAGAGTTGAAGAGAGTTGAAGAGAGTTGAAGAGAGT
TGAAGAGAGAGTTGAAGAGAGTTGAAGAGAGTTGAAGAGAGTTGAAGAGACAAGAGACAGAGACAAACAGGTCCT
AACAAAACACATCAAGGTCACCGGCGACTTCGCCCTCACAGCCCTCGCCATCGCCCGCGAAGCCGGCATCGTAAC
CAGCCCCCAAGTCGACACAGCCGAGAACCTCGACACAACGCCCCGCCTCCCAGACTCTGGCTCAGGCTCGGAAGA
CGCAGACGAGAAGAAAGGCGGCACGACCGTCATCACCGGCCGCGACGCCCTCGTCATCAGCGGCCCCCAACTCAC
CCGTCTCAGCGACGGTCAGTGGCGTCTCCTCACCGAGTACGACGAGATCGTCTTCGCCCGCACGACGCCGGAGCA
GAAGCTGCGCATCGTTCGAGAGTTTCAGCGTGAGAGCGTCGTGGCCATGACGGGTGATGGCGTGAATGACGCGCC
TTCTCTCAAGGCTGCTGACGTTGGTATCGCCCTGGGCAGCGGATCTGATATCGCCATGGAGGCTGCGGATATGAT
TCTGCTCGAGTCGTTTTCCTCCGTTGTCGTGGCTGTGCAATACGGCCGTGTTGTCTTTGACAATCTCAAAAAGGT
TGGTTGTGCTTGCGATTGATCTGTGCGGCGTGTGTTTGAGTTGAGTGTCTGTGGCTCACTCCATCGTCCCTCCCA
GGTCATCGCCTATCTACTACCGGCCGGCAGTTTCTCCGAGTTCTGGCCCGTCATGACATCCGTCATCTTTGGCCT
GCCGCAGATTCTGTCGTCGTTTCTCATGATTATCATCTGGTACGTTGAAAAGCAGCAACTCGCACTCGCTCACAA
CCCTTTCCCCCTTTCCCCCTTTCCCTATCCATCCCCTTCATCCCACTCTCCAACCCCCCCATCTCCTCTCAACTA
ACCAAACCAGCTGCTTCACCGACTGCGCCGCCGCAACGATCCTCTCCTTCGAAAAGCCCGAAGCCGACGTCCTCA
CCCGCCCCCCCCGCAACGTCAAGAAGGACAGGCTCGTCAACTGGCAGCTTGTCCTACACGCCTACGGCATCGTCG
GCATGACCGAGACAATCGCCTCCTTCGCCATGTCCTTCTGGTACCTGCAACGCAACGGCATCGCCTTCCGAGACC
TGTGGTTCAGCTTCGGCCAGCTGCCTCCCGGCATTGAGAAGCCCTACTACGATCAGAAGCTGGCCGAGGCGTCGT
CCATCTACTTCGTCAACCTCGTCGTCATGCAGTGGTTCAACCTCATGGCTACCCGAACCCGACGGCTTTCCATCT
TCCAGCATCCGCCCATGTTCAATAAGGAGACGCAGAATCTGTACCTCTTCCCGTCCATTCTGTTTGCCCTGGGCA
TGGCCCTGCTTTGGATCTACCCGCCTTCCATTCAGAGCGTCCTGGGAACGGCCAGCATCCCCGTCGAATACTGGT
TCCTCCCCTTTAGCTTCGGTCTGTTCATCATCCTGCTGGACGAGGCGAGGAGATATTGGGTCCGGAGACGGCCCG
ACAGCTGGGTGGCGAGGGCTGCATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail