Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01056
Gene name
Locationscaffold_01:3943652..3945264
Strand+
Gene length (bp)1612
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 3.8E-26 59 196
PF08031 BBE Berberine and berberine like 9.9E-10 460 505

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1346 0.0438 0.9275 0.14 0.0789 0.0226 0.3051 0.4063 0.1582 0.0126

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999713

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA7 1.0E-71 50 260

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3274
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7468
Ophiocordyceps camponoti-floridani Ophcf2|01056 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6672
Ophiocordyceps kimflemingae Ophio5|2376
Ophiocordyceps subramaniannii Hirsu2|5980
Ophiocordyceps subramaniannii Hirsu2|7959

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01056
MTVSGLFRIGILLIPLALAADNDCLQKCLQSAGIPSFFQDQAQFANLSSPYNVRLPFTPAAVVTAEKAEDVSEAV
KCASSCGGFKVQARSGGNSYASHSLGGQNGSIVIDLSSMNQVTVNKDTSAEIGGGVRLGNLDKALFDQGKRAMSH
GTCANVGFGGHSLHGGYGYESRLWGLSLDHIQSLEVVLANGTVAEASPTKNEDLFWAVRGAGESFGVVTKFNIRT
EAAPDSLVYWTFNLSDILKDISTSVAALEHVQDFALNKTVQDRRLTWGWYLDDKTFLLRGKFHGPMDEFNQRIAP
EMLRGLPDPTGDARDVREVGWLQSQALYNHGSDNISELVQPSQPGEYSEHENFYAMSLTSPDPLTKEAITAYLKY
AVNQGAKVKSPSSWYSIVNLYGGPDSQIDVYNSSWSAYGNRDSLWVFQNHATVDLGEPFDNSLPDFISGLNKAVT
KSMPMTSFGAYTNYIDPGLSAKDAHRLYYGELYPRLLDVKKRVDPDQTFSNPLAIGVGDFNKTTERM*
Coding >Ophcf2|01056
ATGACAGTCTCCGGCCTGTTTCGGATAGGAATCCTGCTCATCCCATTGGCTCTGGCTGCAGACAACGACTGCCTC
CAGAAATGCCTGCAGTCGGCAGGAATCCCTTCCTTCTTCCAAGACCAGGCCCAATTTGCAAACTTGTCGAGCCCT
TACAACGTCCGACTGCCGTTCACCCCCGCGGCCGTCGTCACAGCTGAGAAGGCCGAGGACGTCTCCGAAGCTGTC
AAGTGCGCGTCAAGTTGTGGGGGGTTCAAGGTCCAAGCCAGAAGCGGCGGCAACTCGTATGCTTCCCACAGCCTG
GGCGGCCAGAATGGAAGCATCGTCATCGACTTGTCTTCGATGAACCAGGTCACGGTAAACAAAGACACGTCAGCC
GAGATCGGCGGCGGCGTGCGTCTGGGCAATCTCGACAAAGCCCTCTTTGATCAGGGAAAGCGTGCCATGAGCCAC
GGAACCTGTGCCAACGTTGGCTTCGGCGGTCATAGCCTTCACGGGGGTTACGGCTACGAATCGCGACTCTGGGGG
CTGTCTCTGGATCATATTCAGTCGCTGGAGGTTGTGCTCGCCAACGGAACCGTTGCTGAAGCTTCACCCACCAAG
AACGAGGATTTGTTCTGGGCAGTTCGCGGAGCTGGCGAGTCATTCGGCGTCGTCACCAAGTTCAACATCCGTACC
GAGGCCGCACCCGATTCTCTCGTCTACTGGACCTTTAACCTCAGCGATATCCTCAAGGATATCTCGACTTCAGTC
GCCGCTCTGGAACATGTCCAAGATTTTGCTCTGAACAAGACGGTCCAGGATCGCCGTCTGACTTGGGGCTGGTAC
TTGGATGATAAGACTTTCTTGCTTCGGGGCAAGTTTCACGGGCCAATGGATGAGTTCAACCAGCGGATCGCACCC
GAGATGCTGCGTGGTCTTCCGGACCCTACCGGGGATGCTCGGGATGTCAGAGAAGTCGGTTGGCTTCAAAGCCAA
GCACTCTATAATCATGGCTCGGACAACATCTCGGAGCTCGTTCAACCGTCCCAGCCTGGAGAGTACTCGGAGCAT
GAGAACTTCTATGCAATGTCACTCACTTCCCCGGATCCCCTGACCAAGGAGGCTATAACGGCCTATCTCAAGTAT
GCCGTCAACCAAGGGGCCAAGGTGAAGAGCCCGTCCAGCTGGTACAGCATTGTCAACCTCTACGGCGGCCCAGAT
AGTCAGATCGACGTTTACAACAGCTCGTGGTCCGCGTACGGGAACCGCGATTCGCTGTGGGTGTTTCAGAACCAC
GCCACCGTCGACCTGGGGGAACCCTTTGACAACTCCCTGCCCGACTTCATTTCCGGTCTGAACAAAGCCGTGACG
AAAAGTATGCCCATGACTTCTTTCGGGGCGTACACGAACTATATTGATCCGGGGCTGAGCGCCAAAGATGCGCAT
CGACTTTACTACGGGGAGCTGTATCCTCGGCTTCTAGATGTCAAGAAGAGAGTTGATCCCGATCAGACCTTTTCT
AATCCTCTAGCTATTGGGGTGGGTGATTTTAACAAGACAACTGAGCGCATGTAG
Transcript >Ophcf2|01056
ATGACAGTCTCCGGCCTGTTTCGGATAGGAATCCTGCTCATCCCATTGGCTCTGGCTGCAGACAACGACTGCCTC
CAGAAATGCCTGCAGTCGGCAGGAATCCCTTCCTTCTTCCAAGACCAGGCCCAATTTGCAAACTTGTCGAGCCCT
TACAACGTCCGACTGCCGTTCACCCCCGCGGCCGTCGTCACAGCTGAGAAGGCCGAGGACGTCTCCGAAGCTGTC
AAGTGCGCGTCAAGTTGTGGGGGGTTCAAGGTCCAAGCCAGAAGCGGCGGCAACTCGTATGCTTCCCACAGCCTG
GGCGGCCAGAATGGAAGCATCGTCATCGACTTGTCTTCGATGAACCAGGTCACGGTAAACAAAGACACGTCAGCC
GAGATCGGCGGCGGCGTGCGTCTGGGCAATCTCGACAAAGCCCTCTTTGATCAGGGAAAGCGTGCCATGAGCCAC
GGAACCTGTGCCAACGTTGGCTTCGGCGGTCATAGCCTTCACGGGGGTTACGGCTACGAATCGCGACTCTGGGGG
CTGTCTCTGGATCATATTCAGTCGCTGGAGGTTGTGCTCGCCAACGGAACCGTTGCTGAAGCTTCACCCACCAAG
AACGAGGATTTGTTCTGGGCAGTTCGCGGAGCTGGCGAGTCATTCGGCGTCGTCACCAAGTTCAACATCCGTACC
GAGGCCGCACCCGATTCTCTCGTCTACTGGACCTTTAACCTCAGCGATATCCTCAAGGATATCTCGACTTCAGTC
GCCGCTCTGGAACATGTCCAAGATTTTGCTCTGAACAAGACGGTCCAGGATCGCCGTCTGACTTGGGGCTGGTAC
TTGGATGATAAGACTTTCTTGCTTCGGGGCAAGTTTCACGGGCCAATGGATGAGTTCAACCAGCGGATCGCACCC
GAGATGCTGCGTGGTCTTCCGGACCCTACCGGGGATGCTCGGGATGTCAGAGAAGTCGGTTGGCTTCAAAGCCAA
GCACTCTATAATCATGGCTCGGACAACATCTCGGAGCTCGTTCAACCGTCCCAGCCTGGAGAGTACTCGGAGCAT
GAGAACTTCTATGCAATGTCACTCACTTCCCCGGATCCCCTGACCAAGGAGGCTATAACGGCCTATCTCAAGTAT
GCCGTCAACCAAGGGGCCAAGGTGAAGAGCCCGTCCAGCTGGTACAGCATTGTCAACCTCTACGGCGGCCCAGAT
AGTCAGATCGACGTTTACAACAGCTCGTGGTCCGCGTACGGGAACCGCGATTCGCTGTGGGTGTTTCAGAACCAC
GCCACCGTCGACCTGGGGGAACCCTTTGACAACTCCCTGCCCGACTTCATTTCCGGTCTGAACAAAGCCGTGACG
AAAAGTATGCCCATGACTTCTTTCGGGGCGTACACGAACTATATTGATCCGGGGCTGAGCGCCAAAGATGCGCAT
CGACTTTACTACGGGGAGCTGTATCCTCGGCTTCTAGATGTCAAGAAGAGAGTTGATCCCGATCAGACCTTTTCT
AATCCTCTAGCTATTGGGGTGGGTGATTTTAACAAGACAACTGAGCGCATGTAG
Gene >Ophcf2|01056
ATGACAGTCTCCGGCCTGTTTCGGATAGGAATCCTGCTCATCCCATTGGCTCTGGCTGCAGACAACGACTGCCTC
CAGAAATGCCTGCAGTCGGCAGGAATCCCTTCCTTCTTCCAAGACCAGGCCCAATTTGCAAACTTGTCGAGCCCT
TACAACGTCCGACTGCCGTTCACCCCCGCGGCCGTCGTCACAGCTGAGAAGGCCGAGGACGTCTCCGAAGCTGTC
AAGTGCGCGTCAAGTTGTGGGGGGTTCAAGGTACATAAACGCTGCTTTATCCTCTCGCAAGCTTGCTGAGAGACT
CACCGGTTTACAGGTCCAAGCCAGAAGCGGCGGCAACTCGTATGCTTCCCACAGCCTGGGCGGCCAGAATGGAAG
CATCGTCATCGACTTGTCTTCGATGAACCAGGTCACGGTAAACAAAGACACGTCAGCCGAGATCGGCGGCGGCGT
GCGTCTGGGCAATCTCGACAAAGCCCTCTTTGATCAGGGAAAGCGTGCCATGAGCCACGGAACCTGTGCCAACGT
TGGCTTCGGCGGTCATAGCCTTCACGGGGGTTACGGCTACGAATCGCGACTCTGGGGGCTGTCTCTGGATCATAT
TCAGTCGCTGGAGGTTGTGCTCGCCAACGGAACCGTTGCTGAAGCTTCACCCACCAAGAACGAGGATTTGTTCTG
GGCAGTTCGCGGAGCTGGCGAGTCATTCGGCGTCGTCACCAAGTTCAACATCCGTACCGAGGCCGCACCCGATTC
TCTCGTCTACTGGACCTTTAACCTCAGCGATATCCTCAAGGATATCTCGACTTCAGTCGCCGCTCTGGAACATGT
CCAAGATTTTGCTCTGAACAAGACGGTCCAGGATCGCCGTCTGACTTGGGGCTGGTACTTGGATGATAAGACTTT
CTTGCTTCGGGGCAAGTTTCACGGGCCAATGGATGAGTTCAACCAGCGGATCGCACCCGAGATGCTGCGTGGTCT
TCCGGACCCTACCGGGGATGCTCGGGATGTCAGAGAAGTCGGTTGGCTTCAAAGCCAAGCACTCTATAATCATGG
CTCGGACAACATCTCGGAGCTCGTTCAACCGTCCCAGCCTGGAGAGTACTCGGAGCATGAGAACTTCTATGCAAT
GTCACTCACTTCCCCGGATCCCCTGACCAAGGAGGCTATAACGGCCTATCTCAAGTATGCCGTCAACCAAGGGGC
CAAGGTGAAGAGCCCGTCCAGCTGGTACAGCATTGTCAACCTCTACGGCGGCCCAGATAGTCAGATCGACGTTTA
CAACAGCTCGTGGTCCGCGTACGGGAACCGCGATTCGCTGTGGGTGTTTCAGAACCACGCCACCGTCGACCTGGG
GGAACCCTTTGACAACTCCCTGCCCGACTTCATTTCCGGTCTGAACAAAGCCGTGACGAAAAGTATGCCCATGAC
TTCTTTCGGGGCGTACACGAACTATATTGATCCGGGGCTGAGCGCCAAAGATGCGCATCGACTTTACTACGGGGA
GCTGTATCCTCGGCTTCTAGATGTCAAGAAGAGAGTTGATCCCGATCAGACCTTTTCTAATCCTCTAGCTATTGG
GGTGGGTGATTTTAACAAGACAACTGAGCGCATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail