Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01050
Gene name
Locationscaffold_01:3932171..3932506
Strand+
Gene length (bp)335
Transcript length (bp)222
Coding sequence length (bp)222
Protein length (aa) 74

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1241 0.0851 0.9336 0.0433 0.1219 0.0038 0.0909 0.1229 0.0654 0.0044

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999682

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup507
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7417
Ophiocordyceps australis map64 (Brazil) OphauB2|7158
Ophiocordyceps camponoti-floridani Ophcf2|01050 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|02384
Ophiocordyceps kimflemingae Ophio5|6908
Ophiocordyceps subramaniannii Hirsu2|185
Ophiocordyceps subramaniannii Hirsu2|5775
Ophiocordyceps subramaniannii Hirsu2|6831

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01050
MKVFAILALFCASAAAGECKKGLLYCGHTLEFLGISDQCALNAKLKRITDYENHLFECRGPGSAKLIRLLDYS*
Coding >Ophcf2|01050
ATGAAAGTCTTTGCCATTCTCGCCCTTTTCTGCGCCTCTGCTGCGGCGGGAGAATGCAAAAAAGGCCTCCTATAT
TGCGGACACACGTTGGAATTCCTCGGGATTTCTGACCAGTGCGCACTGAATGCGAAGCTGAAGCGAATCACCGAT
TACGAAAATCATCTCTTCGAGTGTAGAGGCCCCGGAAGCGCCAAGTTGATTCGACTCCTCGACTACTCCTAG
Transcript >Ophcf2|01050
ATGAAAGTCTTTGCCATTCTCGCCCTTTTCTGCGCCTCTGCTGCGGCGGGAGAATGCAAAAAAGGCCTCCTATAT
TGCGGACACACGTTGGAATTCCTCGGGATTTCTGACCAGTGCGCACTGAATGCGAAGCTGAAGCGAATCACCGAT
TACGAAAATCATCTCTTCGAGTGTAGAGGCCCCGGAAGCGCCAAGTTGATTCGACTCCTCGACTACTCCTAG
Gene >Ophcf2|01050
ATGAAAGTCTTTGCCATTCTCGCCCTTTTCTGCGCCTCTGCTGCGGCGGGAGAATGCAAAAAAGGCCTCCTATAT
TGCGGACACACGTTGGAATTCCTCGGGAGTGAGCGGTTCACGTACGTATGAGGTGCGAGTCGATGATGGCTAACG
AAGCGATTAGTTTCTGACCAGTGCGCACTGAATGCGAAGCTGAAGCGAATCACCGATTACGAAAATCATCTCTTC
GAGTGTAGAGGCCCCGGAAGCGCCAAGTTGATTCGACTCCTCGACTACTGTGAGAACGGGTGTCAGGATAACGGG
GTGGGGAGACGGGATTACTGCTGTTCGCAGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail