Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01040
Gene name
Locationscaffold_01:3878749..3886576
Strand+
Gene length (bp)7827
Transcript length (bp)7689
Coding sequence length (bp)7689
Protein length (aa) 2563

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01504 PIP5K Phosphatidylinositol-4-phosphate 5-Kinase 7.6E-24 2304 2473
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 4.2E-25 863 1075
PF01363 FYVE FYVE zinc finger 2.7E-14 427 489

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005524 ATP binding Yes
GO:0046488 phosphatidylinositol metabolic process Yes
GO:0016307 phosphatidylinositol phosphate kinase activity Yes
GO:0044255 cellular lipid metabolic process No
GO:0046486 glycerolipid metabolic process No
GO:0003824 catalytic activity No
GO:0016301 kinase activity No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0043169 cation binding No
GO:0006629 lipid metabolic process No
GO:0008152 metabolic process No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044237 cellular metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0006650 glycerophospholipid metabolic process No
GO:0044238 primary metabolic process No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:0006644 phospholipid metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6307 0.3756 0.1108 0.196 0.256 0.0189 0.1259 0.4207 0.2135 0.0371

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4713
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5654
Ophiocordyceps australis map64 (Brazil) OphauB2|7882
Ophiocordyceps camponoti-floridani Ophcf2|01040 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6078
Ophiocordyceps kimflemingae Ophio5|2734
Ophiocordyceps subramaniannii Hirsu2|9914

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01040
MSSTATSKALRDPSPPLVSHHSSASARASADSMSTSSAVDKEQLAHALDKIHITASRCDSLTTFNDFAPPPERTF
TSEGRGSAGDLMQHGLSGLYSRFREVVGGGTGGSPTRSTPKDTDADDDADAVSSRQQGHSTKPSVSSLSRNDTVN
TATNSLSMSQPTPMTEPSTSSITAATSDMSRSQTSQASKPTSMSLMSTQKLLSTSARQSLPTKATSAVVAGPTIA
PPVPREASLGTVRTDDGQGPGRRSIGRPDLHTQLSTADSSSLASGFDANDAGKLPPRAAREDSSSVEGSVDSPLS
PPKTAAVPNVLAAQRRHVRSLSNSSSMLSPDGMRRKPVVIDRISRPRSPGNVGSRESSLDRGTAEVSPVTMSAFN
SGSHGSFGHHAVPHRLRPVRFPGIAAGRERASNRMAAQLDRMRRQVLSKEFWMKDDTVKECFLCQTPFTAFRRKH
HCRTCGCIFDSKCTTVVPGHKFGVQGSLRVCKNCLDVISRRFDGSGSDDSGDERSFMPRIFGPNHPKHPSGSSPG
NKVKETQDLALASEGSEDSRTMATPMMAIPATRRVRGESNRSSAVLEIDAPQLSRPGSSRSLRSLNSGRPQSSAG
HKRHHSKHGFLGRFKAPPPTPPFLPTSMQSPAASDDRAPFRKGIDDDNVKKSKLPAFHDDNIIDPDLADYMSDDS
SGDEQLSIFATMGTSSLQSGSYEIEKSGFAPFINAARKHRHRNGEKSISGISFVSRGVFDDFSGPANLISHRRTA
RRRNLSNVSGSVHHFGSPRPKSAIYKGASASTEMLLSLDNPGQSGSPMTGNESFRNLQPSLPKQELNRSSLRHVD
KLLRQLLTDARISSPAAWQRALVPILLQLTDDVTPDVAKGEDMDIRHYVKLKRIPGGKPSGTTYVSGVVFTKNLA
LKSMPRRIMNPRIVLVTFAIEYQRHQQHFMSLQPVIEQEKEYLRVVVQRITNLRPHVLLAQKSVSGVALQYLSEA
NISVAYNVKDTVIEAVARCAEAEIIESLDMLALPVRVGRCSTFEVRTFVNNDHPGRKKSYIFLSGCRADLGCTIA
LRGADSKTLGRLKQIMEFMVYVVYNLKLETSLLRDECIQPPDAGEASMSSSVQALNDSTRSLSSTSITEPARTDV
AVVVNQPSSESELPSQTTVDSLGPGGGGVSGGLDEADASSQAKPVSLHEQHSHASHDGQVPDDVPMPTFYSDMVA
KYETKILSASPYVKFKQPYLLMRAREQERRLLYLRRLRDQDLLDLDSDKAGRQKFQLIKPEMVEKIGQKAPRQVM
EVLHAVHDAEYDKALFNYQTQTRQWETYIQGNLDLFDPYSHQNIVVLYSVICSETKIPCIEPSLVAINFYDEHVD
TGMDPDCTLGQYIEDLAYGKEDVCNSNGCEKMMLEHHRTYVHDQYRITVFVERMQTSGPRRPELGDGITMWTYCK
LCKKDSTEKAMSDATFKYSFGKYLELLYWGRGLRIKSIAGCPHDHYSEHVRYFCLGDSRIRIHWDPIDLLEIVVP
RARITWKVVNDLRLKNEIFTKMEERWSKFMASVRARLKSIRIDSVLPEKAVCCKAEVERLMKRAQEEQPAMVRQM
QSIYAKSKYYEVVPFNSLVREMLEKAGEWDQVFAKFEADFLGDKDMRQLTIMQLRKMFTDNESKESLVSTEANGS
TVDGDERPSQTLSEADEKSTQLSDQTMADSGLAARCRDDGSIDEKAMAEEDGKARVPVESFMERVEPLDLAASPL
SVKSPQQPATQQKTFFTDESTPHSPTSGQVSPVPPQAVPAPSSPLTSPSRLCRSPTDASFFGSSLTEKMDQMRHD
QPAPAPPLRTSTTSVGAPSLIPKPTPDRTGRPSGSNVSPPMIRASSHPARATPRSQSLVAMKTPGVRDTKSAVSQ
LDPHAEQPLPEAPIKVDKKLSDRLGLSGLKHRSKGTSSSIPRLVHKKRESKVSTLARHFEQLSREFERERIRDRK
QRAASFRQPKARLPRTSTKAIVHVYDDVNQAFEEPAVVTEPVTDGPGEQKPAGAASSIKPEPPTSVGPPTEAITE
PPPPMVEIKAERRLGEDAKEENQRAPSPPPAAEGSGGEGQVQQEINQASSPPTAPAPPVAEENDDVSNANTSQAV
SEDEGGVSDPETAVADDFLPGIKELADALEPSSEIPLELPKHQKTSLMKYLTNFWAERSASGWSPLEYPVNSTDH
IFVDSDIIVREDEPSSVIALALNSEDYKEKLVNLRREAQGVLMHREGDSTGEAVSSTRPASEGTDMMVDETEQEK
SLLRATGTHLKYQFKEGAAVMTCKIFYAEQFDALRRKCGVAERIVESLSRCLKWDSRGGKTKSVFLKTLDDRLVL
KSLSPVETSAFLRFAPGYFSIMAEALFHDLPSVIAKMLGFFQVIIKNPTTGTDTKLDLLITENLFYDRSPSRIFD
LKGSMRNRRIQSTGEQNEVLLDENMVEYIYESPLFAREHSKKLLRASVWNDTLFLARQNVMDYSLMIAVDEERKE
LVVGIIDCIRTYTWDKKLESWIKDRGFAGGGRNRPTVTSPKEYKSRFREAMARYILQAPNCWHLFNGLHYPSNHG
RARFEDPEALSL*
Coding >Ophcf2|01040
ATGTCGAGCACCGCAACCTCCAAGGCTCTTCGGGACCCGTCTCCTCCCTTGGTCTCGCACCACTCGTCTGCCAGC
GCCCGCGCCTCCGCCGATTCCATGTCGACGTCGTCGGCTGTCGACAAGGAGCAGCTCGCTCACGCTCTCGACAAG
ATCCACATCACGGCCAGCCGCTGCGACTCCCTCACCACCTTCAACGACTTTGCGCCCCCTCCCGAACGGACCTTT
ACTTCCGAAGGTCGTGGATCGGCTGGAGATCTGATGCAGCATGGCCTTAGTGGTCTCTACAGTCGCTTCCGGGAA
GTCGTCGGCGGCGGAACCGGCGGTAGTCCCACCAGGTCGACGCCCAAGGACACCGACGCCGACGACGACGCCGAC
GCCGTTTCCTCGAGGCAGCAGGGCCACTCAACCAAGCCTTCTGTATCGTCTCTCAGCCGCAACGACACTGTTAAT
ACGGCCACCAACTCTCTCTCCATGTCCCAGCCGACTCCCATGACTGAACCCTCTACATCGTCCATCACCGCTGCA
ACCTCGGACATGAGCCGTTCGCAGACGTCGCAGGCTTCCAAGCCGACGAGCATGAGTCTCATGTCTACTCAGAAG
CTGCTGTCTACGTCGGCTCGCCAGAGTCTCCCGACAAAGGCTACCAGCGCAGTCGTTGCCGGTCCCACAATCGCC
CCTCCCGTCCCGCGTGAGGCCAGCCTCGGTACCGTCCGCACCGATGACGGCCAGGGCCCAGGTCGTAGGAGCATA
GGCAGACCTGACCTTCACACCCAACTGTCGACAGCCGACTCGTCCTCTCTCGCTAGCGGCTTCGACGCCAACGAT
GCCGGCAAGCTCCCGCCCCGCGCTGCCCGAGAGGACAGCTCTAGTGTCGAGGGCAGCGTCGATTCGCCCCTGAGT
CCACCAAAGACTGCCGCTGTACCTAACGTCCTGGCAGCCCAACGTCGACACGTCCGCAGCCTTTCCAATAGCTCC
TCGATGCTCTCGCCCGACGGTATGCGCAGAAAGCCGGTCGTGATAGACAGGATAAGTCGACCCAGGTCACCCGGC
AACGTGGGATCGCGGGAATCCTCTCTCGATCGCGGAACTGCCGAGGTCAGTCCCGTCACCATGTCTGCCTTCAAC
TCCGGCTCCCATGGATCCTTCGGCCATCATGCCGTTCCGCACCGCCTCCGTCCTGTGCGTTTCCCCGGGATCGCG
GCCGGCAGAGAGAGAGCCTCGAACCGGATGGCCGCCCAGCTGGACAGGATGCGTAGACAGGTGCTGAGCAAGGAG
TTTTGGATGAAGGACGACACCGTCAAGGAGTGTTTTCTGTGCCAGACGCCCTTCACCGCGTTCCGCAGGAAGCAT
CATTGCCGCACCTGCGGCTGCATCTTCGATTCCAAGTGCACCACGGTCGTGCCGGGCCACAAGTTTGGCGTGCAG
GGCTCGCTGCGCGTCTGCAAAAACTGCCTCGATGTCATCAGTCGCCGCTTCGACGGCAGCGGATCCGACGACTCG
GGCGACGAGCGCTCCTTTATGCCGCGAATCTTTGGTCCCAATCACCCCAAGCACCCGAGTGGTAGCTCCCCTGGC
AACAAGGTCAAGGAGACACAGGACCTGGCGCTCGCTTCGGAGGGCTCCGAGGACTCACGAACCATGGCGACGCCC
ATGATGGCCATCCCTGCCACCCGTCGAGTGCGGGGGGAGTCGAATCGCTCATCTGCTGTCCTGGAGATTGACGCA
CCGCAGCTCAGTCGCCCTGGCTCGTCTCGATCCCTAAGGTCCCTGAACTCGGGTCGTCCGCAGTCCTCCGCGGGT
CACAAGAGACACCACTCAAAGCACGGCTTCCTCGGCCGCTTCAAAGCCCCTCCGCCGACGCCTCCCTTTCTCCCG
ACGAGCATGCAGTCGCCTGCCGCCAGCGACGACCGAGCGCCTTTCCGCAAGGGCATCGATGACGACAACGTCAAG
AAATCCAAACTCCCGGCTTTCCACGACGATAACATCATCGATCCCGACTTGGCTGATTACATGTCCGACGATTCG
AGTGGCGACGAGCAGCTGAGCATATTCGCCACCATGGGGACGTCGAGCTTGCAGTCTGGAAGCTACGAAATCGAA
AAATCGGGTTTCGCGCCCTTCATAAACGCAGCCAGGAAGCATCGCCATAGAAACGGCGAAAAGAGCATCAGCGGC
ATAAGCTTCGTTAGCAGAGGTGTGTTCGACGACTTCAGCGGCCCTGCGAACCTTATCAGCCACCGGCGGACTGCA
CGGCGACGGAATCTCAGCAACGTGTCCGGCAGCGTCCATCACTTCGGCTCCCCGCGGCCCAAGTCGGCCATATAC
AAGGGCGCCTCGGCATCGACTGAGATGCTCCTGTCTCTCGATAACCCGGGCCAGTCCGGATCGCCCATGACCGGC
AACGAATCCTTCCGGAATCTCCAGCCGTCGCTCCCTAAGCAGGAGCTAAACCGATCGAGCCTCAGACACGTGGAC
AAGCTTCTTCGCCAGCTCCTGACAGATGCCCGAATATCATCCCCCGCGGCATGGCAGAGGGCACTCGTCCCGATC
CTTCTGCAGCTGACCGACGATGTGACCCCGGACGTGGCCAAGGGCGAGGACATGGACATTAGACACTACGTCAAG
CTCAAGCGCATCCCTGGCGGCAAGCCCTCCGGCACTACCTACGTCTCCGGCGTCGTCTTCACCAAGAACCTGGCG
CTCAAGAGCATGCCGCGAAGGATCATGAACCCGAGGATCGTTCTCGTCACTTTTGCCATCGAGTACCAGCGCCAT
CAGCAACACTTTATGAGCCTGCAGCCCGTCATCGAGCAGGAAAAGGAGTATCTGAGAGTCGTGGTCCAGCGCATC
ACCAATCTGAGACCCCACGTGCTGCTGGCGCAGAAGAGCGTCTCGGGCGTCGCCTTGCAATATCTCTCCGAGGCC
AACATCTCGGTGGCGTACAATGTCAAGGACACCGTCATCGAGGCCGTCGCTCGCTGCGCCGAGGCCGAGATCATC
GAGTCTCTAGACATGCTGGCGCTGCCTGTGCGCGTCGGCCGGTGCTCTACCTTTGAAGTGAGGACTTTTGTCAAC
AACGATCACCCAGGCCGAAAGAAATCCTACATCTTTCTGTCTGGATGCCGGGCCGATCTGGGCTGTACCATCGCC
CTTCGAGGCGCCGACAGCAAGACTCTCGGCCGGCTGAAGCAGATCATGGAGTTCATGGTCTACGTCGTCTACAAT
CTGAAGCTCGAGACGAGCCTCTTGCGAGACGAGTGCATCCAACCTCCCGATGCCGGCGAAGCGTCCATGTCGAGC
TCCGTCCAGGCTTTGAACGATAGCACGAGGTCTCTGAGCTCAACGAGCATCACGGAACCTGCCCGAACCGATGTT
GCCGTCGTTGTGAACCAACCGTCCAGCGAGAGCGAGCTGCCGTCGCAAACCACCGTGGACAGTCTCGGCCCGGGA
GGCGGTGGCGTCAGCGGCGGGCTCGACGAAGCCGACGCCTCGAGTCAAGCAAAGCCAGTGTCCCTCCATGAGCAA
CACAGTCACGCGTCTCACGACGGTCAGGTGCCGGATGACGTCCCGATGCCGACCTTTTACAGCGATATGGTGGCC
AAGTACGAGACCAAGATCCTGTCGGCCTCGCCGTACGTGAAATTTAAGCAGCCTTACCTCCTTATGAGGGCGCGC
GAGCAGGAGAGGCGCCTCCTGTATCTCCGACGGCTCAGAGACCAAGATCTGCTCGATCTGGACTCCGACAAGGCG
GGCCGGCAAAAATTTCAGCTCATCAAGCCGGAAATGGTTGAGAAGATTGGCCAAAAGGCCCCCCGGCAGGTCATG
GAGGTCCTCCACGCGGTGCACGACGCCGAGTACGACAAGGCCTTGTTCAACTACCAGACCCAGACGCGGCAGTGG
GAGACGTACATACAAGGGAACCTGGATCTCTTCGACCCTTACTCGCACCAGAACATCGTCGTGCTGTATTCCGTC
ATCTGCTCCGAGACTAAGATCCCCTGCATCGAACCCAGCCTTGTCGCCATCAACTTCTACGACGAGCACGTAGAC
ACGGGCATGGATCCGGACTGCACGCTCGGCCAGTACATCGAAGACCTGGCATATGGTAAGGAAGACGTCTGCAAC
TCGAACGGGTGCGAAAAGATGATGCTGGAGCACCACCGGACATACGTGCACGATCAATACCGCATCACTGTCTTC
GTGGAGCGCATGCAGACGAGCGGCCCGAGGCGTCCAGAGCTCGGCGACGGCATCACCATGTGGACCTACTGCAAA
CTGTGCAAGAAGGACTCTACAGAGAAGGCCATGTCGGACGCTACGTTCAAGTACTCGTTTGGCAAGTATCTCGAG
CTGCTCTATTGGGGCCGTGGCCTGCGGATCAAGAGCATCGCGGGATGCCCTCACGACCACTACTCGGAACACGTT
CGATACTTTTGCTTAGGCGACTCGCGCATCCGCATCCACTGGGACCCCATCGATCTGCTCGAGATTGTCGTGCCT
CGAGCGAGGATCACGTGGAAAGTGGTCAATGACTTGAGGCTGAAGAATGAGATCTTCACCAAAATGGAGGAGCGT
TGGAGCAAGTTCATGGCTTCGGTGAGGGCAAGACTGAAGAGCATCCGCATCGACAGTGTTCTGCCCGAAAAGGCC
GTCTGCTGCAAGGCCGAGGTGGAGCGGCTGATGAAGAGAGCGCAAGAGGAGCAGCCGGCCATGGTTCGCCAGATG
CAGAGTATCTACGCCAAGTCCAAGTACTACGAGGTGGTCCCGTTCAACAGCCTGGTGCGCGAGATGCTCGAGAAG
GCGGGCGAGTGGGATCAGGTCTTTGCCAAGTTCGAGGCAGACTTTCTGGGAGACAAAGACATGCGACAGCTGACG
ATAATGCAACTGAGGAAGATGTTTACGGACAACGAGTCCAAGGAATCGCTGGTTTCGACCGAAGCCAACGGGTCG
ACTGTTGACGGAGATGAAAGACCATCCCAGACACTTTCGGAGGCGGACGAGAAGAGCACCCAGCTCTCGGACCAA
ACCATGGCCGATTCGGGTCTCGCTGCTAGATGCAGGGACGACGGGTCAATCGACGAAAAGGCAATGGCTGAAGAA
GACGGCAAAGCCAGAGTCCCTGTTGAGAGCTTCATGGAACGAGTCGAGCCGCTAGACCTCGCAGCTTCACCTCTG
TCCGTCAAGAGTCCTCAACAGCCGGCGACTCAGCAGAAGACCTTTTTCACAGACGAGAGCACGCCGCACAGCCCT
ACGTCGGGCCAAGTCTCTCCCGTGCCTCCTCAGGCTGTTCCCGCACCATCTTCGCCGTTGACGTCTCCGTCACGG
CTGTGCCGCAGTCCCACAGACGCATCCTTCTTCGGCTCGTCTCTGACAGAAAAGATGGACCAGATGCGTCACGAC
CAGCCAGCCCCGGCCCCTCCCTTGCGGACATCGACGACGAGCGTCGGAGCTCCTTCGCTAATACCCAAGCCGACG
CCCGACCGCACGGGCCGACCGTCCGGATCGAACGTTTCGCCGCCTATGATTCGGGCCTCGTCGCATCCGGCACGA
GCAACGCCTCGATCCCAGTCATTGGTTGCGATGAAGACGCCCGGAGTTAGGGACACCAAGAGCGCCGTCAGCCAG
TTGGATCCGCATGCCGAACAGCCGCTGCCCGAGGCTCCTATCAAAGTGGATAAGAAACTCTCTGATAGGCTTGGC
CTATCTGGTCTGAAGCATCGCTCCAAAGGAACCTCATCCAGCATCCCGCGGCTGGTTCACAAAAAGAGGGAGTCA
AAAGTGTCTACTTTAGCCAGACACTTTGAGCAGCTCAGCCGCGAGTTCGAGAGAGAGCGTATCCGTGATCGCAAA
CAGAGGGCTGCCAGTTTTCGGCAGCCCAAAGCGAGGTTGCCGAGGACATCGACCAAAGCCATCGTACACGTGTAC
GATGATGTCAATCAGGCTTTCGAAGAGCCTGCCGTGGTAACGGAGCCCGTAACGGACGGACCGGGCGAGCAGAAG
CCGGCCGGCGCGGCATCAAGCATCAAACCCGAACCGCCGACGTCGGTGGGACCGCCGACAGAGGCTATCACGGAA
CCGCCCCCGCCGATGGTGGAAATCAAGGCCGAGAGAAGGCTCGGGGAAGATGCCAAAGAAGAGAACCAGAGGGCG
CCATCGCCGCCACCCGCGGCCGAGGGCAGCGGTGGTGAAGGCCAAGTTCAGCAAGAAATCAACCAAGCATCTTCG
CCACCAACTGCGCCGGCGCCTCCAGTCGCTGAAGAGAACGACGATGTCAGCAATGCCAACACCAGCCAAGCCGTC
TCGGAAGACGAGGGCGGCGTCAGCGATCCGGAGACTGCCGTCGCCGACGACTTCCTCCCAGGTATCAAAGAACTT
GCCGACGCCTTGGAGCCAAGCTCCGAAATTCCGCTGGAGCTCCCCAAGCATCAAAAGACCAGTCTCATGAAGTAC
TTGACCAACTTTTGGGCGGAGAGATCGGCCAGTGGGTGGTCGCCTCTCGAGTACCCCGTCAACTCGACGGATCAC
ATCTTTGTCGATTCCGACATCATCGTGCGAGAGGACGAGCCGAGCTCAGTCATCGCGCTGGCTCTCAACAGTGAG
GACTACAAAGAGAAGCTGGTCAACCTCAGACGCGAGGCGCAGGGAGTCCTGATGCACCGGGAGGGCGACAGCACA
GGCGAGGCGGTGTCGAGCACCCGTCCGGCGTCCGAGGGCACGGACATGATGGTGGATGAGACGGAGCAGGAGAAG
AGCCTCCTTCGCGCCACCGGCACGCATCTCAAGTACCAGTTCAAGGAGGGCGCGGCCGTCATGACGTGCAAGATC
TTTTACGCAGAGCAGTTTGACGCACTCCGTCGAAAGTGCGGCGTGGCCGAGCGCATTGTCGAATCCTTGTCTCGC
TGTCTCAAATGGGACTCTAGAGGTGGAAAGACGAAGTCTGTTTTCCTAAAGACGCTGGACGACAGGCTGGTGCTC
AAGTCTCTCTCGCCTGTCGAGACGTCAGCATTCCTGCGATTCGCGCCGGGATACTTTAGCATCATGGCAGAAGCT
CTCTTTCATGATCTTCCTTCTGTCATCGCCAAGATGCTGGGCTTTTTCCAGGTCATCATCAAGAACCCGACGACA
GGCACCGATACTAAGCTCGACCTGCTCATCACCGAGAATCTTTTTTACGATAGGTCGCCCTCGAGGATTTTTGAC
CTCAAGGGCTCGATGCGCAACCGCAGGATTCAGTCGACGGGCGAGCAGAACGAGGTTCTTCTCGACGAGAATATG
GTTGAGTACATCTACGAATCACCCTTATTTGCCCGGGAGCATTCCAAAAAGCTTCTGCGGGCGTCGGTGTGGAAC
GACACGCTGTTTCTTGCGCGCCAGAATGTGATGGACTACTCGCTCATGATTGCCGTCGACGAGGAGAGAAAGGAG
CTCGTGGTCGGCATCATCGACTGCATCAGAACATACACGTGGGACAAGAAGCTTGAGAGCTGGATAAAGGACCGC
GGATTCGCTGGCGGAGGCAGGAATAGACCTACGGTGACGAGCCCCAAGGAGTACAAGTCGCGGTTCCGAGAGGCC
ATGGCGAGGTATATTCTGCAAGCTCCCAACTGCTGGCATCTGTTTAACGGCCTACACTACCCGTCTAATCACGGG
AGAGCGAGGTTCGAAGACCCTGAGGCTCTGTCGCTCTAG
Transcript >Ophcf2|01040
ATGTCGAGCACCGCAACCTCCAAGGCTCTTCGGGACCCGTCTCCTCCCTTGGTCTCGCACCACTCGTCTGCCAGC
GCCCGCGCCTCCGCCGATTCCATGTCGACGTCGTCGGCTGTCGACAAGGAGCAGCTCGCTCACGCTCTCGACAAG
ATCCACATCACGGCCAGCCGCTGCGACTCCCTCACCACCTTCAACGACTTTGCGCCCCCTCCCGAACGGACCTTT
ACTTCCGAAGGTCGTGGATCGGCTGGAGATCTGATGCAGCATGGCCTTAGTGGTCTCTACAGTCGCTTCCGGGAA
GTCGTCGGCGGCGGAACCGGCGGTAGTCCCACCAGGTCGACGCCCAAGGACACCGACGCCGACGACGACGCCGAC
GCCGTTTCCTCGAGGCAGCAGGGCCACTCAACCAAGCCTTCTGTATCGTCTCTCAGCCGCAACGACACTGTTAAT
ACGGCCACCAACTCTCTCTCCATGTCCCAGCCGACTCCCATGACTGAACCCTCTACATCGTCCATCACCGCTGCA
ACCTCGGACATGAGCCGTTCGCAGACGTCGCAGGCTTCCAAGCCGACGAGCATGAGTCTCATGTCTACTCAGAAG
CTGCTGTCTACGTCGGCTCGCCAGAGTCTCCCGACAAAGGCTACCAGCGCAGTCGTTGCCGGTCCCACAATCGCC
CCTCCCGTCCCGCGTGAGGCCAGCCTCGGTACCGTCCGCACCGATGACGGCCAGGGCCCAGGTCGTAGGAGCATA
GGCAGACCTGACCTTCACACCCAACTGTCGACAGCCGACTCGTCCTCTCTCGCTAGCGGCTTCGACGCCAACGAT
GCCGGCAAGCTCCCGCCCCGCGCTGCCCGAGAGGACAGCTCTAGTGTCGAGGGCAGCGTCGATTCGCCCCTGAGT
CCACCAAAGACTGCCGCTGTACCTAACGTCCTGGCAGCCCAACGTCGACACGTCCGCAGCCTTTCCAATAGCTCC
TCGATGCTCTCGCCCGACGGTATGCGCAGAAAGCCGGTCGTGATAGACAGGATAAGTCGACCCAGGTCACCCGGC
AACGTGGGATCGCGGGAATCCTCTCTCGATCGCGGAACTGCCGAGGTCAGTCCCGTCACCATGTCTGCCTTCAAC
TCCGGCTCCCATGGATCCTTCGGCCATCATGCCGTTCCGCACCGCCTCCGTCCTGTGCGTTTCCCCGGGATCGCG
GCCGGCAGAGAGAGAGCCTCGAACCGGATGGCCGCCCAGCTGGACAGGATGCGTAGACAGGTGCTGAGCAAGGAG
TTTTGGATGAAGGACGACACCGTCAAGGAGTGTTTTCTGTGCCAGACGCCCTTCACCGCGTTCCGCAGGAAGCAT
CATTGCCGCACCTGCGGCTGCATCTTCGATTCCAAGTGCACCACGGTCGTGCCGGGCCACAAGTTTGGCGTGCAG
GGCTCGCTGCGCGTCTGCAAAAACTGCCTCGATGTCATCAGTCGCCGCTTCGACGGCAGCGGATCCGACGACTCG
GGCGACGAGCGCTCCTTTATGCCGCGAATCTTTGGTCCCAATCACCCCAAGCACCCGAGTGGTAGCTCCCCTGGC
AACAAGGTCAAGGAGACACAGGACCTGGCGCTCGCTTCGGAGGGCTCCGAGGACTCACGAACCATGGCGACGCCC
ATGATGGCCATCCCTGCCACCCGTCGAGTGCGGGGGGAGTCGAATCGCTCATCTGCTGTCCTGGAGATTGACGCA
CCGCAGCTCAGTCGCCCTGGCTCGTCTCGATCCCTAAGGTCCCTGAACTCGGGTCGTCCGCAGTCCTCCGCGGGT
CACAAGAGACACCACTCAAAGCACGGCTTCCTCGGCCGCTTCAAAGCCCCTCCGCCGACGCCTCCCTTTCTCCCG
ACGAGCATGCAGTCGCCTGCCGCCAGCGACGACCGAGCGCCTTTCCGCAAGGGCATCGATGACGACAACGTCAAG
AAATCCAAACTCCCGGCTTTCCACGACGATAACATCATCGATCCCGACTTGGCTGATTACATGTCCGACGATTCG
AGTGGCGACGAGCAGCTGAGCATATTCGCCACCATGGGGACGTCGAGCTTGCAGTCTGGAAGCTACGAAATCGAA
AAATCGGGTTTCGCGCCCTTCATAAACGCAGCCAGGAAGCATCGCCATAGAAACGGCGAAAAGAGCATCAGCGGC
ATAAGCTTCGTTAGCAGAGGTGTGTTCGACGACTTCAGCGGCCCTGCGAACCTTATCAGCCACCGGCGGACTGCA
CGGCGACGGAATCTCAGCAACGTGTCCGGCAGCGTCCATCACTTCGGCTCCCCGCGGCCCAAGTCGGCCATATAC
AAGGGCGCCTCGGCATCGACTGAGATGCTCCTGTCTCTCGATAACCCGGGCCAGTCCGGATCGCCCATGACCGGC
AACGAATCCTTCCGGAATCTCCAGCCGTCGCTCCCTAAGCAGGAGCTAAACCGATCGAGCCTCAGACACGTGGAC
AAGCTTCTTCGCCAGCTCCTGACAGATGCCCGAATATCATCCCCCGCGGCATGGCAGAGGGCACTCGTCCCGATC
CTTCTGCAGCTGACCGACGATGTGACCCCGGACGTGGCCAAGGGCGAGGACATGGACATTAGACACTACGTCAAG
CTCAAGCGCATCCCTGGCGGCAAGCCCTCCGGCACTACCTACGTCTCCGGCGTCGTCTTCACCAAGAACCTGGCG
CTCAAGAGCATGCCGCGAAGGATCATGAACCCGAGGATCGTTCTCGTCACTTTTGCCATCGAGTACCAGCGCCAT
CAGCAACACTTTATGAGCCTGCAGCCCGTCATCGAGCAGGAAAAGGAGTATCTGAGAGTCGTGGTCCAGCGCATC
ACCAATCTGAGACCCCACGTGCTGCTGGCGCAGAAGAGCGTCTCGGGCGTCGCCTTGCAATATCTCTCCGAGGCC
AACATCTCGGTGGCGTACAATGTCAAGGACACCGTCATCGAGGCCGTCGCTCGCTGCGCCGAGGCCGAGATCATC
GAGTCTCTAGACATGCTGGCGCTGCCTGTGCGCGTCGGCCGGTGCTCTACCTTTGAAGTGAGGACTTTTGTCAAC
AACGATCACCCAGGCCGAAAGAAATCCTACATCTTTCTGTCTGGATGCCGGGCCGATCTGGGCTGTACCATCGCC
CTTCGAGGCGCCGACAGCAAGACTCTCGGCCGGCTGAAGCAGATCATGGAGTTCATGGTCTACGTCGTCTACAAT
CTGAAGCTCGAGACGAGCCTCTTGCGAGACGAGTGCATCCAACCTCCCGATGCCGGCGAAGCGTCCATGTCGAGC
TCCGTCCAGGCTTTGAACGATAGCACGAGGTCTCTGAGCTCAACGAGCATCACGGAACCTGCCCGAACCGATGTT
GCCGTCGTTGTGAACCAACCGTCCAGCGAGAGCGAGCTGCCGTCGCAAACCACCGTGGACAGTCTCGGCCCGGGA
GGCGGTGGCGTCAGCGGCGGGCTCGACGAAGCCGACGCCTCGAGTCAAGCAAAGCCAGTGTCCCTCCATGAGCAA
CACAGTCACGCGTCTCACGACGGTCAGGTGCCGGATGACGTCCCGATGCCGACCTTTTACAGCGATATGGTGGCC
AAGTACGAGACCAAGATCCTGTCGGCCTCGCCGTACGTGAAATTTAAGCAGCCTTACCTCCTTATGAGGGCGCGC
GAGCAGGAGAGGCGCCTCCTGTATCTCCGACGGCTCAGAGACCAAGATCTGCTCGATCTGGACTCCGACAAGGCG
GGCCGGCAAAAATTTCAGCTCATCAAGCCGGAAATGGTTGAGAAGATTGGCCAAAAGGCCCCCCGGCAGGTCATG
GAGGTCCTCCACGCGGTGCACGACGCCGAGTACGACAAGGCCTTGTTCAACTACCAGACCCAGACGCGGCAGTGG
GAGACGTACATACAAGGGAACCTGGATCTCTTCGACCCTTACTCGCACCAGAACATCGTCGTGCTGTATTCCGTC
ATCTGCTCCGAGACTAAGATCCCCTGCATCGAACCCAGCCTTGTCGCCATCAACTTCTACGACGAGCACGTAGAC
ACGGGCATGGATCCGGACTGCACGCTCGGCCAGTACATCGAAGACCTGGCATATGGTAAGGAAGACGTCTGCAAC
TCGAACGGGTGCGAAAAGATGATGCTGGAGCACCACCGGACATACGTGCACGATCAATACCGCATCACTGTCTTC
GTGGAGCGCATGCAGACGAGCGGCCCGAGGCGTCCAGAGCTCGGCGACGGCATCACCATGTGGACCTACTGCAAA
CTGTGCAAGAAGGACTCTACAGAGAAGGCCATGTCGGACGCTACGTTCAAGTACTCGTTTGGCAAGTATCTCGAG
CTGCTCTATTGGGGCCGTGGCCTGCGGATCAAGAGCATCGCGGGATGCCCTCACGACCACTACTCGGAACACGTT
CGATACTTTTGCTTAGGCGACTCGCGCATCCGCATCCACTGGGACCCCATCGATCTGCTCGAGATTGTCGTGCCT
CGAGCGAGGATCACGTGGAAAGTGGTCAATGACTTGAGGCTGAAGAATGAGATCTTCACCAAAATGGAGGAGCGT
TGGAGCAAGTTCATGGCTTCGGTGAGGGCAAGACTGAAGAGCATCCGCATCGACAGTGTTCTGCCCGAAAAGGCC
GTCTGCTGCAAGGCCGAGGTGGAGCGGCTGATGAAGAGAGCGCAAGAGGAGCAGCCGGCCATGGTTCGCCAGATG
CAGAGTATCTACGCCAAGTCCAAGTACTACGAGGTGGTCCCGTTCAACAGCCTGGTGCGCGAGATGCTCGAGAAG
GCGGGCGAGTGGGATCAGGTCTTTGCCAAGTTCGAGGCAGACTTTCTGGGAGACAAAGACATGCGACAGCTGACG
ATAATGCAACTGAGGAAGATGTTTACGGACAACGAGTCCAAGGAATCGCTGGTTTCGACCGAAGCCAACGGGTCG
ACTGTTGACGGAGATGAAAGACCATCCCAGACACTTTCGGAGGCGGACGAGAAGAGCACCCAGCTCTCGGACCAA
ACCATGGCCGATTCGGGTCTCGCTGCTAGATGCAGGGACGACGGGTCAATCGACGAAAAGGCAATGGCTGAAGAA
GACGGCAAAGCCAGAGTCCCTGTTGAGAGCTTCATGGAACGAGTCGAGCCGCTAGACCTCGCAGCTTCACCTCTG
TCCGTCAAGAGTCCTCAACAGCCGGCGACTCAGCAGAAGACCTTTTTCACAGACGAGAGCACGCCGCACAGCCCT
ACGTCGGGCCAAGTCTCTCCCGTGCCTCCTCAGGCTGTTCCCGCACCATCTTCGCCGTTGACGTCTCCGTCACGG
CTGTGCCGCAGTCCCACAGACGCATCCTTCTTCGGCTCGTCTCTGACAGAAAAGATGGACCAGATGCGTCACGAC
CAGCCAGCCCCGGCCCCTCCCTTGCGGACATCGACGACGAGCGTCGGAGCTCCTTCGCTAATACCCAAGCCGACG
CCCGACCGCACGGGCCGACCGTCCGGATCGAACGTTTCGCCGCCTATGATTCGGGCCTCGTCGCATCCGGCACGA
GCAACGCCTCGATCCCAGTCATTGGTTGCGATGAAGACGCCCGGAGTTAGGGACACCAAGAGCGCCGTCAGCCAG
TTGGATCCGCATGCCGAACAGCCGCTGCCCGAGGCTCCTATCAAAGTGGATAAGAAACTCTCTGATAGGCTTGGC
CTATCTGGTCTGAAGCATCGCTCCAAAGGAACCTCATCCAGCATCCCGCGGCTGGTTCACAAAAAGAGGGAGTCA
AAAGTGTCTACTTTAGCCAGACACTTTGAGCAGCTCAGCCGCGAGTTCGAGAGAGAGCGTATCCGTGATCGCAAA
CAGAGGGCTGCCAGTTTTCGGCAGCCCAAAGCGAGGTTGCCGAGGACATCGACCAAAGCCATCGTACACGTGTAC
GATGATGTCAATCAGGCTTTCGAAGAGCCTGCCGTGGTAACGGAGCCCGTAACGGACGGACCGGGCGAGCAGAAG
CCGGCCGGCGCGGCATCAAGCATCAAACCCGAACCGCCGACGTCGGTGGGACCGCCGACAGAGGCTATCACGGAA
CCGCCCCCGCCGATGGTGGAAATCAAGGCCGAGAGAAGGCTCGGGGAAGATGCCAAAGAAGAGAACCAGAGGGCG
CCATCGCCGCCACCCGCGGCCGAGGGCAGCGGTGGTGAAGGCCAAGTTCAGCAAGAAATCAACCAAGCATCTTCG
CCACCAACTGCGCCGGCGCCTCCAGTCGCTGAAGAGAACGACGATGTCAGCAATGCCAACACCAGCCAAGCCGTC
TCGGAAGACGAGGGCGGCGTCAGCGATCCGGAGACTGCCGTCGCCGACGACTTCCTCCCAGGTATCAAAGAACTT
GCCGACGCCTTGGAGCCAAGCTCCGAAATTCCGCTGGAGCTCCCCAAGCATCAAAAGACCAGTCTCATGAAGTAC
TTGACCAACTTTTGGGCGGAGAGATCGGCCAGTGGGTGGTCGCCTCTCGAGTACCCCGTCAACTCGACGGATCAC
ATCTTTGTCGATTCCGACATCATCGTGCGAGAGGACGAGCCGAGCTCAGTCATCGCGCTGGCTCTCAACAGTGAG
GACTACAAAGAGAAGCTGGTCAACCTCAGACGCGAGGCGCAGGGAGTCCTGATGCACCGGGAGGGCGACAGCACA
GGCGAGGCGGTGTCGAGCACCCGTCCGGCGTCCGAGGGCACGGACATGATGGTGGATGAGACGGAGCAGGAGAAG
AGCCTCCTTCGCGCCACCGGCACGCATCTCAAGTACCAGTTCAAGGAGGGCGCGGCCGTCATGACGTGCAAGATC
TTTTACGCAGAGCAGTTTGACGCACTCCGTCGAAAGTGCGGCGTGGCCGAGCGCATTGTCGAATCCTTGTCTCGC
TGTCTCAAATGGGACTCTAGAGGTGGAAAGACGAAGTCTGTTTTCCTAAAGACGCTGGACGACAGGCTGGTGCTC
AAGTCTCTCTCGCCTGTCGAGACGTCAGCATTCCTGCGATTCGCGCCGGGATACTTTAGCATCATGGCAGAAGCT
CTCTTTCATGATCTTCCTTCTGTCATCGCCAAGATGCTGGGCTTTTTCCAGGTCATCATCAAGAACCCGACGACA
GGCACCGATACTAAGCTCGACCTGCTCATCACCGAGAATCTTTTTTACGATAGGTCGCCCTCGAGGATTTTTGAC
CTCAAGGGCTCGATGCGCAACCGCAGGATTCAGTCGACGGGCGAGCAGAACGAGGTTCTTCTCGACGAGAATATG
GTTGAGTACATCTACGAATCACCCTTATTTGCCCGGGAGCATTCCAAAAAGCTTCTGCGGGCGTCGGTGTGGAAC
GACACGCTGTTTCTTGCGCGCCAGAATGTGATGGACTACTCGCTCATGATTGCCGTCGACGAGGAGAGAAAGGAG
CTCGTGGTCGGCATCATCGACTGCATCAGAACATACACGTGGGACAAGAAGCTTGAGAGCTGGATAAAGGACCGC
GGATTCGCTGGCGGAGGCAGGAATAGACCTACGGTGACGAGCCCCAAGGAGTACAAGTCGCGGTTCCGAGAGGCC
ATGGCGAGGTATATTCTGCAAGCTCCCAACTGCTGGCATCTGTTTAACGGCCTACACTACCCGTCTAATCACGGG
AGAGCGAGGTTCGAAGACCCTGAGGCTCTGTCGCTCTAG
Gene >Ophcf2|01040
ATGTCGAGCACCGCAACCTCCAAGGCTCTTCGGGACCCGTCTCCTCCCTTGGTCTCGCACCACTCGTCTGCCAGC
GCCCGCGCCTCCGCCGATTCCATGTCGACGTCGTCGGCTGTCGACAAGGAGCAGCTCGCTCACGCTCTCGACAAG
ATCCACATCACGGCCAGCCGCTGCGACTCCCTCACCACCTTCAACGACTTTGCGCCCCCTCCCGAACGGACCTTT
ACTTCCGAAGGTCGTGGATCGGCTGGAGATCTGATGCAGCATGGCCTTAGTGGTCTCTACAGTCGCTTCCGGGAA
GTCGTCGGCGGCGGAACCGGCGGTAGTCCCACCAGGTCGACGCCCAAGGACACCGACGCCGACGACGACGCCGAC
GCCGTTTCCTCGAGGCAGCAGGGCCACTCAACCAAGCCTTCTGTATCGTCTCTCAGCCGCAACGACACTGTTAAT
ACGGCCACCAACTCTCTCTCCATGTCCCAGCCGACTCCCATGACTGAACCCTCTACATCGTCCATCACCGCTGCA
ACCTCGGACATGAGCCGTTCGCAGACGTCGCAGGCTTCCAAGCCGACGAGCATGAGTCTCATGTCTACTCAGAAG
CTGCTGTCTACGTCGGCTCGCCAGAGTCTCCCGACAAAGGCTACCAGCGCAGTCGTTGCCGGTCCCACAATCGCC
CCTCCCGTCCCGCGTGAGGCCAGCCTCGGTACCGTCCGCACCGATGACGGCCAGGGCCCAGGTCGTAGGAGCATA
GGCAGACCTGACCTTCACACCCAACTGTCGACAGCCGACTCGTCCTCTCTCGCTAGCGGCTTCGACGCCAACGAT
GCCGGCAAGCTCCCGCCCCGCGCTGCCCGAGAGGACAGCTCTAGTGTCGAGGGCAGCGTCGATTCGCCCCTGAGT
CCACCAAAGACTGCCGCTGTACCTAACGTCCTGGCAGCCCAACGTCGACACGTCCGCAGCCTTTCCAATAGCTCC
TCGATGCTCTCGCCCGACGGTATGCGCAGAAAGCCGGTCGTGATAGACAGGATAAGTCGACCCAGGTCACCCGGC
AACGTGGGATCGCGGGAATCCTCTCTCGATCGCGGAACTGCCGAGGTCAGTCCCGTCACCATGTCTGCCTTCAAC
TCCGGCTCCCATGGATCCTTCGGCCATCATGCCGTTCCGCACCGCCTCCGTCCTGTGCGTTTCCCCGGGATCGCG
GCCGGCAGAGAGAGAGCCTCGAACCGGATGGCCGCCCAGCTGGACAGGATGCGTAGACAGGTGCTGAGCAAGGAG
TTTTGGATGAAGGACGACACCGTCAAGGAGTGTTTTCTGTGCCAGACGCCCTTCACCGCGTTCCGCAGGAAGCAT
CATTGCCGCACCTGCGGCTGCATCTTCGATTCCAAGTGCACCACGGTCGTGCCGGGCCACAAGTTTGGCGTGCAG
GGCTCGCTGCGCGTCTGCAAAAACTGCCTCGATGTCATCAGTCGCCGCTTCGACGGCAGCGGATCCGACGACTCG
GGCGACGAGCGCTCCTTTATGCCGCGAATCTTTGGTCCCAATCACCCCAAGCACCCGAGTGGTAGCTCCCCTGGC
AACAAGGTCAAGGAGACACAGGACCTGGCGCTCGCTTCGGAGGGCTCCGAGGACTCACGAACCATGGCGACGCCC
ATGATGGCCATCCCTGCCACCCGTCGAGTGCGGGGGGAGTCGAATCGCTCATCTGCTGTCCTGGAGATTGACGCA
CCGCAGCTCAGTCGCCCTGGCTCGTCTCGATCCCTAAGGTCCCTGAACTCGGGTCGTCCGCAGTCCTCCGCGGGT
CACAAGAGACACCACTCAAAGCACGGCTTCCTCGGCCGCTTCAAAGCCCCTCCGCCGACGCCTCCCTTTCTCCCG
ACGAGCATGCAGTCGCCTGCCGCCAGCGACGACCGAGCGCCTTTCCGCAAGGGCATCGATGACGACAACGTCAAG
AAATCCAAACTCCCGGCTTTCCACGACGATAACATCATCGATCCCGACTTGGCTGATTACATGTCCGACGATTCG
AGTGGCGACGAGCAGCTGAGCATATTCGCCACCATGGGGACGTCGAGCTTGCAGTCTGGAAGCTACGAAATCGAA
AAATCGGGTTTCGCGCCCTTCATAAACGCAGCCAGGAAGCATCGCCATAGAAACGGCGAAAAGAGCATCAGCGGC
ATAAGCTTCGTTAGCAGAGGTGTGTTCGACGACTTCAGCGGCCCTGCGAACCTTATCAGCCACCGGCGGACTGCA
CGGCGACGGAATCTCAGCAACGTGTCCGGCAGCGTCCATCACTTCGGCTCCCCGCGGCCCAAGTCGGCCATATAC
AAGGGCGCCTCGGCATCGACTGAGATGCTCCTGTCTCTCGATAACCCGGGCCAGTCCGGATCGCCCATGACCGGC
AACGAATCCTTCCGGAATCTCCAGCCGTCGCTCCCTAAGCAGGAGCTAAACCGATCGAGCCTCAGACACGTGGAC
AAGCTTCTTCGCCAGCTCCTGACAGATGCCCGAATATCATCCCCCGCGGCATGGCAGAGGGCACTCGTCCCGATC
CTTCTGCAGCTGACCGACGATGTGACCCCGGACGTGGCCAAGGGCGAGGACATGGACATTAGACACTACGTCAAG
CTCAAGCGCATCCCTGGCGGCAAGCCCTCCGGCACTACCTACGTCTCCGGCGTCGTCTTCACCAAGAACCTGGCG
CTCAAGAGCATGCCGCGAAGGATCATGAACCCGAGGATCGTTCTCGTCACTTTTGCCATCGAGTACCAGCGCCAT
CAGCAACACTTTATGAGCCTGCAGCCCGTCATCGAGCAGGAAAAGGAGTATCTGAGAGTCGTGGTCCAGCGCATC
ACCAATCTGAGACCCCACGTGCTGCTGGCGCAGAAGAGCGTCTCGGGCGTCGCCTTGCAATATCTCTCCGAGGCC
AACATCTCGGTGGCGTACAATGTCAAGGACACCGTCATCGAGGCCGTCGCTCGCTGCGCCGAGGCCGAGATCATC
GAGTCTCTAGACATGCTGGCGCTGCCTGTGCGCGTCGGCCGGTGCTCTACCTTTGAAGTGAGGACTTTTGTCAAC
AACGATCACCCAGGCCGAAAGAAATCCTACATCTTTCTGTCTGGATGCCGGGCCGATCTGGGCTGTACCATCGCC
CTTCGAGGCGCCGACAGCAAGACTCTCGGCCGGCTGAAGCAGATCATGGAGTTCATGGTCTACGTCGTCTACAAT
CTGAAGCTCGAGACGAGCCTCTTGCGAGACGAGTGCATCCAACCTCCCGATGCCGGCGAAGCGTCCATGTCGAGC
TCCGTCCAGGCTTTGAACGATAGCACGAGGTCTCTGAGCTCAACGAGCATCACGGAACCTGCCCGAACCGATGTT
GCCGTCGTTGTGAACCAACCGTCCAGCGAGAGCGAGCTGCCGTCGCAAACCACCGTGGACAGTCTCGGCCCGGGA
GGCGGTGGCGTCAGCGGCGGGCTCGACGAAGCCGACGCCTCGAGTCAAGCAAAGCCAGTGTCCCTCCATGAGCAA
CACAGTCACGCGTCTCACGACGGTCAGGTGCCGGATGACGTCCCGATGCCGACCTTTTACAGCGATATGGTGGCC
AAGTACGAGACCAAGATCCTGTCGGCCTCGCCGTACGTGAAATTTAAGCAGCCTTACCTCCTTATGAGGGCGCGC
GAGCAGGAGAGGCGCCTCCTGTATCTCCGACGGCTCAGAGACCAAGATCTGCTCGATCTGGACTCCGACAAGGCG
GGCCGGCAAAAATTTCAGCTCATCAAGCCGGAAATGGTTGAGAAGATTGGCCAAAAGGCCCCCCGGCAGGTCATG
GAGGTCCTCCACGCGGTGCACGACGCCGAGTACGACAAGGCCTTGTTCAACTACCAGACCCAGACGCGGCAGTGG
GAGACGTACATACAAGGGAACCTGGATCTCTTCGACCCTTACTCGCACCAGAACATCGTCGTGCTGTATTCCGTC
ATCTGCTCCGAGACTAAGATCCCCTGCATCGAACCCAGCCTTGTCGCCATCAACTTCTACGACGAGCACGTAGAC
ACGGGCATGGATCCGGACTGCACGCTCGGCCAGTACATCGAAGACCTGGCATATGGTAAGGAAGACGTCTGCAAC
TCGAACGGGTGCGAAAAGATGATGCTGGAGCACCACCGGACATACGTGCACGATCAATACCGCATCACTGTCTTC
GTGGAGCGCATGCAGACGAGCGGCCCGAGGCGTCCAGAGCTCGGCGACGGCATCACCATGTGGACCTACTGCAAA
CTGTGCAAGAAGGACTCTACAGAGAAGGCCATGTCGGACGCTACGTTCAAGTACTCGTTTGGCAAGTATCTCGAG
CTGCTCTATTGGGGCCGTGGCCTGCGGATCAAGAGCATCGCGGGATGCCCTCACGACCACTACTCGGAACACGTT
CGATACTTTTGCTTAGGCGACTCGCGCATCCGCATCCACTGGGACCCCATCGATCTGCTCGAGATTGTCGTGCCT
CGAGCGAGGATCACGTGGAAAGTGGTCAATGACTTGAGGCTGAAGAATGAGATCTTCACCAAAATGGAGGAGCGT
TGGAGCAAGTTCATGGCTTCGGTGAGGGCAAGACTGAAGAGCATCCGCATCGACAGTGTTCTGCCCGAAAAGGCC
GTCTGCTGCAAGGCCGAGGTGGAGCGGCTGATGAAGAGAGCGCAAGAGGAGCAGCCGGCCATGGTTCGCCAGATG
CAGAGTATCTACGCCAAGTCCAAGTACTACGAGGTGGTCCCGTTCAACAGCCTGGTGCGCGAGATGCTCGAGAAG
GCGGGCGAGTGGGATCAGGTCTTTGCCAAGTTCGAGGCAGACTTTCTGGGAGACAAAGACATGCGACAGCTGACG
ATAATGCAACTGAGGAAGATGTTTACGGACAACGAGTCCAAGGAATCGCTGGTTTCGACCGAAGCCAACGGGTCG
ACTGTTGACGGAGATGAAAGACCATCCCAGACACTTTCGGAGGCGGACGAGAAGAGCACCCAGCTCTCGGACCAA
ACCATGGCCGATTCGGGTCTCGCTGCTAGATGCAGGGACGACGGGTCAATCGACGAAAAGGCAATGGCTGAAGAA
GACGGCAAAGCCAGAGTCCCTGTTGAGAGCTTCATGGAACGAGTCGAGCCGCTAGACCTCGCAGCTTCACCTCTG
TCCGTCAAGAGTCCTCAACAGCCGGCGACTCAGCAGAAGACCTTTTTCACAGACGAGAGCACGCCGCACAGCCCT
ACGTCGGGCCAAGTCTCTCCCGTGCCTCCTCAGGCTGTTCCCGCACCATCTTCGCCGTTGACGTCTCCGTCACGG
CTGTGCCGCAGTCCCACAGACGCATCCTTCTTCGGCTCGTCTCTGACAGAAAAGATGGACCAGATGCGTCACGAC
CAGCCAGCCCCGGCCCCTCCCTTGCGGACATCGACGACGAGCGTCGGAGCTCCTTCGCTAATACCCAAGCCGACG
CCCGACCGCACGGGCCGACCGTCCGGATCGAACGTTTCGCCGCCTATGATTCGGGCCTCGTCGCATCCGGCACGA
GCAACGCCTCGATCCCAGTCATTGGTTGCGATGAAGACGCCCGGAGTTAGGGACACCAAGAGCGCCGTCAGCCAG
TTGGATCCGCATGCCGAACAGCCGCTGCCCGAGGCTCCTATCAAAGTGGATAAGAAACTCTCTGATAGGCTTGGC
CTATCTGGTCTGAAGCATCGCTCCAAAGGAACCTCATCCAGCATCCCGCGGCTGGTTCACAAAAAGAGGGAGTCA
AAAGTGTCTACTTTAGCCAGACACTTTGAGCAGCTCAGCCGCGAGTTCGAGAGAGAGCGTATCCGTGATCGCAAA
CAGAGGGCTGCCAGTTTTCGGCAGCCCAAAGCGAGGTTGCCGAGGACATCGACCAAAGCCATCGTACACGTGTAC
GATGATGTCAATCAGGCTTTCGAAGAGCCTGCCGTGGTAACGGAGCCCGTAACGGACGGACCGGGCGAGCAGAAG
CCGGCCGGCGCGGCATCAAGCATCAAACCCGAACCGCCGACGTCGGTGGGACCGCCGACAGAGGCTATCACGGAA
CCGCCCCCGCCGATGGTGGAAATCAAGGCCGAGAGAAGGCTCGGGGAAGATGCCAAAGAAGAGAACCAGAGGGCG
CCATCGCCGCCACCCGCGGCCGAGGGCAGCGGTGGTGAAGGCCAAGTTCAGCAAGAAATCAACCAAGCATCTTCG
CCACCAACTGCGCCGGCGCCTCCAGTCGCTGAAGAGAACGACGATGTCAGCAATGCCAACACCAGCCAAGCCGTC
TCGGAAGACGAGGGCGGCGTCAGCGATCCGGAGACTGCCGTCGCCGACGACTTCCTCCCAGGTATCAAAGAACTT
GCCGACGCCTTGGAGCCAAGCTCCGAAATTCCGCTGGAGCTCCCCAAGCATCAAAAGACCAGTCTCATGAAGTAC
TTGACCAACTTTTGGGCGGAGAGATCGGCCAGTGGGTGGTCGCCTCTCGAGTACCCCGTCAACTCGACGGATCAC
ATCTTTGTCGATTCCGACATCATCGTGCGAGAGGACGAGCCGAGCTCAGTCATCGCGCTGGCTCTCAACAGTGAG
GACTACAAAGAGAAGCTGGTCAACCTCAGACGCGAGGCGCAGGGAGTCCTGATGCACCGGGAGGGCGACAGCACA
GGCGAGGCGGTGTCGAGCACCCGTCCGGCGTCCGAGGGCACGGACATGATGGTGGATGAGACGGAGCAGGAGAAG
AGCCTCCTTCGCGCCACCGGCACGCATCTCAAGTACCAGTTCAAGGAGGGCGCGGCCGTCATGACGTGCAAGATC
TTTTACGCAGAGCAGTTTGACGCACTCCGTCGAAAGTGCGGCGTGGCCGAGCGCATTGTCGAATCCTTGTCTCGC
TGTCTCAAATGGGACTCTAGAGGTGGAAAGACGAAGTCTGTTTTCCTAAAGACGCTGGACGACAGGCTGGTGCTC
AAGGTAAGCTCCCCCCCCCCCCCCCCCCCCCTTTTTTATTTTATTTTCTTTCTGTGTGGCCAGAAGTATCAGAGC
TGATGAGTAGCAGTCTCTCTCGCCTGTCGAGACGTCAGCATTCCTGCGATTCGCGCCGGGATACTTTAGCATCAT
GGCAGAAGCTCTCTTTCATGATCTTCCTTCTGTCATCGCCAAGATGCTGGGCTTTTTCCAGGTCATCATCAAGAA
CCCGACGACAGGCACCGATACTAAGCTCGACCTGCTCATCACCGAGAATCTTTTTTACGATAGGTCGCCCTCGAG
GATTTTTGACCTCAAGGGCTCGATGCGCAACCGCAGGATTCAGTCGACGGGCGAGCAGAACGAGGTTCTTCTCGA
CGAGAATATGGTTGAGTACATCTACGAATCACCCTTATTTGCCCGGGAGCATTCCAAAAAGCTTCTGCGGGCGTC
GGTGTGGAACGACACGCTGTTTCTTGCGCGCCAGAATGTGATGGACTACTCGCTCATGATTGCCGTCGACGAGGA
GAGAAAGGAGCTCGTGGTCGGCATCATCGACTGCATCAGAACATACACGTGGGACAAGAAGCTTGAGAGCTGGAT
AAAGGACCGCGGATTCGCTGGCGGAGGCAGGAATAGACCTACGGTGACGAGCCCCAAGGAGTACAAGTCGCGGTT
CCGAGAGGCCATGGCGAGGTCTGTCTACCCAGTCACCGTGATGCTGGCTCGTGCTGACTTATTGAACACAGGTAT
ATTCTGCAAGCTCCCAACTGCTGGCATCTGTTTAACGGCCTACACTACCCGTCTAATCACGGGAGAGCGAGGTTC
GAAGACCCTGAGGCTCTGTCGCTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail