Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01033
Gene name
Locationscaffold_01:3860045..3862610
Strand-
Gene length (bp)2565
Transcript length (bp)2412
Coding sequence length (bp)2412
Protein length (aa) 804

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04734 Ceramidase_alk Neutral/alkaline non-lysosomal ceramidase, N-terminal 3.3E-188 112 634
PF17048 Ceramidse_alk_C Neutral/alkaline non-lysosomal ceramidase, C-terminal 6.5E-47 640 799

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1885 0.1208 0.9008 0.0521 0.1027 0.0104 0.3736 0.2456 0.2367 0.0143

SignalP

SignalP signal predicted Location Score
Yes 1 - 30 0.999702

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup74
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|149
Ophiocordyceps australis 1348a (Ghana) OphauG2|4414
Ophiocordyceps australis 1348a (Ghana) OphauG2|5649
Ophiocordyceps australis map64 (Brazil) OphauB2|502
Ophiocordyceps australis map64 (Brazil) OphauB2|5266
Ophiocordyceps australis map64 (Brazil) OphauB2|7887
Ophiocordyceps camponoti-floridani Ophcf2|01033 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|01218
Ophiocordyceps camponoti-floridani Ophcf2|02102
Ophiocordyceps camponoti-rufipedis Ophun1|1793
Ophiocordyceps camponoti-rufipedis Ophun1|6086
Ophiocordyceps kimflemingae Ophio5|1151
Ophiocordyceps kimflemingae Ophio5|2727
Ophiocordyceps kimflemingae Ophio5|723
Ophiocordyceps subramaniannii Hirsu2|3661
Ophiocordyceps subramaniannii Hirsu2|7981

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01033
MVSLRPASTALRPCSLVWLLLVLCLGDAFALSDQSPRNDQRGRLPNGLPPQSKPSSVPGNFQSVTPLNAESIFAR
SSVVPDGFAGTGSSRRPQERTFKQQQPRPQPSRRNKFLIGIGKADITGPVSELVMAGYAHDDQIASGLRQRMYCR
AFIIADINRPEERLLYLVLDNINSDTSIRTGLLEALANSDDDLSYYNQHNLAVSSVHSHSGPSTGWNYFLAQVPQ
SGFDRQGQQAVIDGALLSIKRAQSGLQEGYLDLAEIDIPDASVSRSLWAYLANPVEERAKYAREIDTTMTGLRFR
QASDGKIKGILTWFPVHGTSLYGNNTHITGDNKGLASWMLEQKLRQSPAFTKDFIGAFGQANEADVSPNTDGAWC
EDGSGQQCNFTDSSCPDGLVTKCHGRGPMFRAMDLGVSSCHEIARRQAVKAEELLVSPRTRWTPIEAQLGVKGYH
FYHDMAFWRFKTLEGREAMTCPAALGFSFAAGTTDGPGLFDFVQGDANPVPKNPLWTFAFGLVKAASRRQKICQV
PKPILFNGGQLTAPYDWSPNIVDVAMFRIGQLFIILSPSELTTMSGRRWREAIRKEADKFMKRVRPIVVTASPVN
SYSHYLATKEEYDIQRYEGASTLFGRWQLDAYMNLSVSSMHYLVPGNQDLPEQGTLPPDNRRKSFNSNNPVPPDL
ESRTPGYGAVLSQPKSRYVIGQNVQATFQGANPRNNLRLEDTYAAVEQLSKDGNWTRVRDDEDWFLVFTWRRTGR
FLKRGEEVDITWETKGNAKPGIYRLKYYGDAKTRFQGLQPIEGTSKSFALYAR*
Coding >Ophcf2|01033
ATGGTTTCCTTGCGTCCTGCTTCGACGGCTCTGCGGCCTTGCTCGCTCGTCTGGCTGTTGCTCGTGCTGTGTCTT
GGTGATGCATTCGCTCTTTCTGACCAGTCTCCTCGGAACGACCAAAGAGGCCGTCTTCCAAATGGCTTGCCGCCC
CAATCTAAGCCGTCTTCTGTCCCGGGTAATTTCCAATCAGTAACACCGCTCAACGCTGAGTCGATTTTCGCTCGG
TCGTCTGTCGTCCCGGATGGCTTCGCGGGCACCGGCTCCAGTCGACGGCCTCAGGAGCGCACCTTTAAGCAGCAG
CAACCAAGGCCTCAACCTTCTAGGCGCAACAAGTTCCTCATCGGCATCGGCAAAGCCGACATCACTGGACCCGTC
TCCGAGCTCGTCATGGCTGGCTATGCGCATGACGACCAAATAGCATCGGGGCTTCGACAGCGTATGTACTGTCGA
GCTTTCATCATTGCCGATATCAACAGGCCGGAAGAGCGTCTACTGTACTTGGTGCTTGACAATATCAACAGTGAC
ACGTCCATTCGTACCGGTCTCCTCGAAGCACTTGCCAACAGCGACGACGACCTGTCCTACTACAATCAACACAAC
CTTGCCGTCTCGTCTGTTCACAGCCACTCTGGTCCCTCAACAGGCTGGAATTACTTCTTGGCTCAGGTCCCACAG
TCCGGATTCGATCGCCAGGGTCAGCAAGCCGTCATTGATGGCGCGCTTCTTTCCATTAAGCGAGCCCAAAGCGGT
CTGCAAGAGGGTTATCTCGATCTCGCTGAAATCGACATCCCCGACGCCAGCGTCAGTCGTTCTCTATGGGCCTAT
CTTGCCAACCCGGTCGAAGAGAGGGCCAAATATGCGCGAGAGATAGACACAACAATGACAGGACTTCGTTTCAGA
CAGGCGTCGGATGGCAAGATCAAAGGCATCTTGACCTGGTTTCCCGTCCATGGCACCTCTCTCTACGGTAATAAC
ACGCATATAACAGGCGACAACAAGGGTCTGGCTTCTTGGATGCTCGAGCAAAAGTTGCGACAATCTCCCGCGTTC
ACAAAGGACTTTATCGGTGCTTTCGGCCAAGCAAATGAGGCCGATGTCTCTCCCAACACCGATGGGGCCTGGTGC
GAGGACGGCTCCGGACAGCAGTGCAACTTCACCGACTCTTCATGTCCTGACGGCCTGGTGACAAAATGCCACGGC
AGAGGTCCCATGTTTCGAGCCATGGACTTGGGCGTCAGCAGCTGCCACGAGATCGCCCGGCGACAGGCCGTCAAA
GCCGAGGAATTGTTGGTTTCGCCTCGCACGCGTTGGACCCCGATAGAGGCGCAACTCGGTGTCAAAGGCTACCAC
TTTTATCATGACATGGCCTTTTGGAGATTCAAGACACTGGAAGGTCGCGAGGCCATGACGTGTCCCGCCGCCCTG
GGATTCTCCTTTGCCGCTGGCACGACTGATGGCCCAGGGCTATTCGACTTTGTTCAGGGGGACGCTAATCCGGTG
CCCAAGAATCCGCTATGGACATTCGCCTTTGGCTTGGTCAAGGCTGCCAGCCGCCGACAGAAAATCTGTCAAGTG
CCCAAACCCATCTTATTCAACGGCGGCCAGTTGACGGCTCCTTACGATTGGTCACCAAATATTGTCGACGTCGCC
ATGTTTCGGATCGGCCAACTATTCATTATTCTTAGCCCGAGCGAACTGACCACCATGAGCGGTCGACGATGGAGA
GAAGCCATCAGAAAGGAAGCCGACAAGTTTATGAAACGTGTCCGCCCAATCGTCGTCACTGCCAGCCCGGTTAAC
TCTTATTCCCATTACCTCGCGACCAAGGAAGAGTACGACATTCAGCGGTACGAAGGGGCCTCGACGTTGTTCGGC
CGCTGGCAGCTGGACGCTTACATGAACCTAAGTGTCAGTAGCATGCACTATCTGGTGCCGGGCAACCAGGATCTT
CCGGAGCAAGGCACGCTGCCTCCCGATAACCGGAGGAAATCATTCAACAGCAACAACCCCGTTCCCCCGGACCTC
GAATCGCGGACACCGGGCTATGGAGCGGTCCTGAGCCAGCCCAAATCCAGATACGTCATCGGACAAAACGTGCAA
GCCACGTTCCAAGGGGCCAATCCTCGTAACAACCTACGTTTAGAAGACACATATGCCGCCGTCGAGCAGCTCAGT
AAAGATGGTAATTGGACGCGCGTACGCGATGATGAGGACTGGTTCCTAGTTTTCACATGGCGAAGAACAGGTCGC
TTCCTGAAGCGTGGCGAAGAGGTCGACATCACGTGGGAAACAAAGGGAAACGCGAAGCCGGGAATCTATCGGCTC
AAGTATTACGGCGATGCGAAGACGAGGTTTCAAGGACTTCAGCCCATCGAGGGCACGAGCAAGAGCTTTGCGCTA
TATGCCAGGTGA
Transcript >Ophcf2|01033
ATGGTTTCCTTGCGTCCTGCTTCGACGGCTCTGCGGCCTTGCTCGCTCGTCTGGCTGTTGCTCGTGCTGTGTCTT
GGTGATGCATTCGCTCTTTCTGACCAGTCTCCTCGGAACGACCAAAGAGGCCGTCTTCCAAATGGCTTGCCGCCC
CAATCTAAGCCGTCTTCTGTCCCGGGTAATTTCCAATCAGTAACACCGCTCAACGCTGAGTCGATTTTCGCTCGG
TCGTCTGTCGTCCCGGATGGCTTCGCGGGCACCGGCTCCAGTCGACGGCCTCAGGAGCGCACCTTTAAGCAGCAG
CAACCAAGGCCTCAACCTTCTAGGCGCAACAAGTTCCTCATCGGCATCGGCAAAGCCGACATCACTGGACCCGTC
TCCGAGCTCGTCATGGCTGGCTATGCGCATGACGACCAAATAGCATCGGGGCTTCGACAGCGTATGTACTGTCGA
GCTTTCATCATTGCCGATATCAACAGGCCGGAAGAGCGTCTACTGTACTTGGTGCTTGACAATATCAACAGTGAC
ACGTCCATTCGTACCGGTCTCCTCGAAGCACTTGCCAACAGCGACGACGACCTGTCCTACTACAATCAACACAAC
CTTGCCGTCTCGTCTGTTCACAGCCACTCTGGTCCCTCAACAGGCTGGAATTACTTCTTGGCTCAGGTCCCACAG
TCCGGATTCGATCGCCAGGGTCAGCAAGCCGTCATTGATGGCGCGCTTCTTTCCATTAAGCGAGCCCAAAGCGGT
CTGCAAGAGGGTTATCTCGATCTCGCTGAAATCGACATCCCCGACGCCAGCGTCAGTCGTTCTCTATGGGCCTAT
CTTGCCAACCCGGTCGAAGAGAGGGCCAAATATGCGCGAGAGATAGACACAACAATGACAGGACTTCGTTTCAGA
CAGGCGTCGGATGGCAAGATCAAAGGCATCTTGACCTGGTTTCCCGTCCATGGCACCTCTCTCTACGGTAATAAC
ACGCATATAACAGGCGACAACAAGGGTCTGGCTTCTTGGATGCTCGAGCAAAAGTTGCGACAATCTCCCGCGTTC
ACAAAGGACTTTATCGGTGCTTTCGGCCAAGCAAATGAGGCCGATGTCTCTCCCAACACCGATGGGGCCTGGTGC
GAGGACGGCTCCGGACAGCAGTGCAACTTCACCGACTCTTCATGTCCTGACGGCCTGGTGACAAAATGCCACGGC
AGAGGTCCCATGTTTCGAGCCATGGACTTGGGCGTCAGCAGCTGCCACGAGATCGCCCGGCGACAGGCCGTCAAA
GCCGAGGAATTGTTGGTTTCGCCTCGCACGCGTTGGACCCCGATAGAGGCGCAACTCGGTGTCAAAGGCTACCAC
TTTTATCATGACATGGCCTTTTGGAGATTCAAGACACTGGAAGGTCGCGAGGCCATGACGTGTCCCGCCGCCCTG
GGATTCTCCTTTGCCGCTGGCACGACTGATGGCCCAGGGCTATTCGACTTTGTTCAGGGGGACGCTAATCCGGTG
CCCAAGAATCCGCTATGGACATTCGCCTTTGGCTTGGTCAAGGCTGCCAGCCGCCGACAGAAAATCTGTCAAGTG
CCCAAACCCATCTTATTCAACGGCGGCCAGTTGACGGCTCCTTACGATTGGTCACCAAATATTGTCGACGTCGCC
ATGTTTCGGATCGGCCAACTATTCATTATTCTTAGCCCGAGCGAACTGACCACCATGAGCGGTCGACGATGGAGA
GAAGCCATCAGAAAGGAAGCCGACAAGTTTATGAAACGTGTCCGCCCAATCGTCGTCACTGCCAGCCCGGTTAAC
TCTTATTCCCATTACCTCGCGACCAAGGAAGAGTACGACATTCAGCGGTACGAAGGGGCCTCGACGTTGTTCGGC
CGCTGGCAGCTGGACGCTTACATGAACCTAAGTGTCAGTAGCATGCACTATCTGGTGCCGGGCAACCAGGATCTT
CCGGAGCAAGGCACGCTGCCTCCCGATAACCGGAGGAAATCATTCAACAGCAACAACCCCGTTCCCCCGGACCTC
GAATCGCGGACACCGGGCTATGGAGCGGTCCTGAGCCAGCCCAAATCCAGATACGTCATCGGACAAAACGTGCAA
GCCACGTTCCAAGGGGCCAATCCTCGTAACAACCTACGTTTAGAAGACACATATGCCGCCGTCGAGCAGCTCAGT
AAAGATGGTAATTGGACGCGCGTACGCGATGATGAGGACTGGTTCCTAGTTTTCACATGGCGAAGAACAGGTCGC
TTCCTGAAGCGTGGCGAAGAGGTCGACATCACGTGGGAAACAAAGGGAAACGCGAAGCCGGGAATCTATCGGCTC
AAGTATTACGGCGATGCGAAGACGAGGTTTCAAGGACTTCAGCCCATCGAGGGCACGAGCAAGAGCTTTGCGCTA
TATGCCAGGTGA
Gene >Ophcf2|01033
ATGGTTTCCTTGCGTCCTGCTTCGACGGCTCTGCGGCCTTGCTCGCTCGTCTGGCTGTTGCTCGTGCTGTGTCTT
GGTGATGCATTCGCTCTTTCTGACCAGTCTCCTCGGAACGACCAAAGAGGCCGTCTTCCAAATGGCTTGCCGCCC
CAATCTAAGCCGTCTTCTGTCCCGGGTAATTTCCAATCAGTAACACCGCTCAACGCTGAGTCGATTTTCGCTCGG
TCGTCTGTCGTCCCGGATGGCTTCGCGGGCACCGGCTCCAGTCGACGGCCTCAGGAGCGCACCTTTAAGCAGCAG
CAACCAAGGCCTCAACCTTCTAGGCGCAACAAGTTCCTCATCGGCATCGGCAAAGCCGACATCACTGGACCCGTC
TCCGAGCTCGTCATGGCTGGCTATGCGCATGACGACCAAATAGCATCGGGGCTTCGACAGCGTATGTACTGTCGA
GCTTTCATCATTGCCGATATCAACAGGCCGGAAGAGCGTCTACTGTACTTGGTGCTTGACAATATCAACAGTGAC
ACGTCCATTCGTACCGGTCTCCTCGAAGCACTTGCCAACAGCGACGACGACCTGTCCTACTACAATCAACACAAC
CTTGCCGTCTCGTCTGTTCACAGCCACTCTGGTCCCTCAACAGGCTGGAATTACTTCTTGGCTCAGGTCCCACAG
TCCGGATTCGATCGCCAGGGTCAGCAAGCCGTCATTGATGGCGCGCTTCTTTCCATTAAGCGAGCCCAAAGCGGT
CTGCAAGAGGTGAGTCTCATCCTTTACGGGGTGTTTTGCGCTTTGTCTTGACGTTCATCAACTCGCATAGGGTTA
TCTCGATCTCGCTGAAATCGACATCCCCGACGCCAGCGTCAGTCGTTCTCTATGGGCCTATCTTGCCAACCCGGT
CGAAGAGAGGGCCAAATATGCGCGAGAGATAGACACAACAATGACAGGACTTCGTTTCAGACAGGCGTCGGATGG
CAAGATCAAAGGCATCTTGACCTGGTTTCCCGTCCATGGCACCTCTCTCTACGGTAATAACACGCATATAACAGG
CGACAACAAGGGTCTGGCTTCTTGGATGCTCGAGCAAAAGTTGCGACAATCTCCCGCGTTCACAAAGGACTTTAT
CGGTGCTTTCGGCCAAGCAAATGAGGCCGATGTCTCTCCCAACACCGATGGGGCCTGGTGCGAGGACGGCTCCGG
ACAGCAGTGCAACTTCACCGACTCTTCATGTCCTGACGGCCTGGTGACAAAATGCCACGGCAGAGGTCCCATGTT
TCGAGCCATGGACTTGGGCGTCAGCAGCTGCCACGAGATCGCCCGGCGACAGGCCGTCAAAGCCGAGGAATTGTT
GGTGAGTGAGACGCCCCTTGTCATCCACCCCGATCGTCTATCTGACCGTTGTTGCGTTTCTTTTCTTTTCTTTTT
TTTTTTTTTTAAATTCAGGTTTCGCCTCGCACGCGTTGGACCCCGATAGAGGCGCAACTCGGTGTCAAAGGCTAC
CACTTTTATCATGACATGGCCTTTTGGAGATTCAAGACACTGGAAGGTCGCGAGGCCATGACGTGTCCCGCCGCC
CTGGGATTCTCCTTTGCCGCTGGCACGACTGATGGCCCAGGGCTATTCGACTTTGTTCAGGGGGACGCTAATCCG
GTGCCCAAGAATCCGCTATGGACATTCGCCTTTGGCTTGGTCAAGGCTGCCAGCCGCCGACAGAAAATCTGTCAA
GTGCCCAAACCCATCTTATTCAACGGCGGCCAGTTGACGGCTCCTTACGATTGGTCACCAAATATTGTCGACGTC
GCCATGTTTCGGATCGGCCAACTATTCATTATTCTTAGCCCGAGCGAACTGACCACCATGAGCGGTCGACGATGG
AGAGAAGCCATCAGAAAGGAAGCCGACAAGTTTATGAAACGTGTCCGCCCAATCGTCGTCACTGCCAGCCCGGTT
AACTCTTATTCCCATTACCTCGCGACCAAGGAAGAGTACGACATTCAGCGGTACGAAGGGGCCTCGACGTTGTTC
GGCCGCTGGCAGCTGGACGCTTACATGAACCTAAGTGTCAGTAGCATGCACTATCTGGTGCCGGGCAACCAGGAT
CTTCCGGAGCAAGGCACGCTGCCTCCCGATAACCGGAGGAAATCATTCAACAGCAACAACCCCGTTCCCCCGGAC
CTCGAATCGCGGACACCGGGCTATGGAGCGGTCCTGAGCCAGCCCAAATCCAGATACGTCATCGGACAAAACGTG
CAAGCCACGTTCCAAGGGGCCAATCCTCGTAACAACCTACGTTTAGAAGACACATATGCCGCCGTCGAGCAGCTC
AGTAAAGATGGTAATTGGACGCGCGTACGCGATGATGAGGACTGGTTCCTAGTTTTCACATGGCGAAGAACAGGT
CGCTTCCTGAAGCGTGGCGAAGAGGTCGACATCACGTGGGAAACAAAGGGAAACGCGAAGCCGGGAATCTATCGG
CTCAAGTATTACGGCGATGCGAAGACGAGGTTTCAAGGACTTCAGCCCATCGAGGGCACGAGCAAGAGCTTTGCG
CTATATGCCAGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail