Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01031
Gene name
Locationscaffold_01:3853545..3855507
Strand-
Gene length (bp)1962
Transcript length (bp)1962
Coding sequence length (bp)1962
Protein length (aa) 654

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05199 GMC_oxred_C GMC oxidoreductase 6.4E-33 509 645
PF00732 GMC_oxred_N GMC oxidoreductase 2.7E-28 132 401

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01031
MPTPSPLLSPLVLVILLLFAVTASAVELSGYEYIVVGSGAGGGPLAARLAMAGRRTLLIEAGTDQGENVNTTVPA
YATRSNEDPDMSWDFFVRHYSDDEQQARDPKTTYRTADGQRYTGLKPPPGAKMLGVLYPRAAALGGCSVHNALIS
VTPHRSDWDDIARLTGDLSWTSDRMHVYFRRVNREQRPSLFRPPPQDSPIEGVGWLSIEKAPIGILARDPLSASI
LFGGAFAMGNRTGAVNTIGTLLTGDANENSAKRDREGGYYQTPLAAHEGKRMSARDFVVAVRDAKTAEGSQRFPL
DVRTNCQVTRVIFDKEQPPRATGVEFLDGAHLYRASPRSSGSGGELGSATASREVILSAGTFNTPQLLKLSGVGP
AAELARFNISLVHDAPGVGSKLQDHYEVAVQGRAPTNFNLLHGCTFSDDAADDPCLSRWQTPNRLSLTGPRGVYS
SSGALSSMLVRTAAASEYDIFIFGGPFDFRGYYPGFSRDLVASSDLWSWIVLKAHPLNSAGTVTLRSSDPLDVPD
VIFNSFGDDEDGSTDLGAVREGISVARDAFRRQLVPMTEKVPGEKAQSKESLDGYIRDNVFGHHATSTCAIGADD
DPMAVLDSNFRVRGVKGLRVVDASVFPLIPGTFPTLAIYMVAEKAADVILAGK*
Coding >Ophcf2|01031
ATGCCAACTCCATCGCCTCTGCTCTCGCCCCTCGTCCTCGTGATCCTCCTCCTCTTCGCCGTCACCGCCTCGGCC
GTTGAACTATCGGGCTATGAATACATCGTGGTCGGCTCCGGCGCCGGCGGCGGTCCTCTCGCGGCACGGCTGGCG
ATGGCCGGCCGGCGGACGCTGCTAATCGAAGCCGGTACGGATCAAGGCGAGAATGTCAACACGACAGTACCAGCC
TACGCAACTCGCTCCAACGAGGACCCGGACATGTCATGGGACTTCTTTGTACGGCACTATAGCGACGATGAACAG
CAGGCTAGGGACCCGAAGACGACGTACCGCACGGCCGATGGCCAGCGCTACACGGGTCTGAAGCCGCCTCCTGGG
GCCAAGATGCTGGGCGTGCTGTATCCAAGGGCGGCCGCGCTCGGAGGTTGCTCCGTGCACAACGCGCTCATTTCT
GTCACGCCGCACCGGTCCGACTGGGACGATATTGCGAGACTGACGGGAGACTTGTCGTGGACGTCGGATCGCATG
CACGTATACTTCCGACGAGTGAATCGCGAGCAGCGTCCAAGCTTGTTCCGTCCGCCACCGCAGGATTCCCCTATC
GAAGGCGTCGGATGGCTATCGATTGAGAAGGCTCCCATTGGCATCCTCGCACGGGACCCTCTGTCGGCCAGCATC
CTCTTCGGCGGCGCCTTTGCCATGGGGAACCGGACGGGCGCGGTAAACACCATCGGAACCTTACTCACGGGCGAC
GCAAATGAGAACTCAGCCAAGCGCGATCGTGAAGGTGGTTACTATCAGACGCCACTGGCCGCTCACGAAGGAAAA
CGCATGTCGGCGCGGGACTTTGTCGTGGCCGTACGCGATGCTAAGACGGCTGAAGGCTCGCAACGCTTTCCGCTC
GACGTCCGCACCAACTGTCAGGTCACTCGCGTCATCTTCGATAAGGAACAGCCGCCTCGGGCCACGGGGGTAGAG
TTCCTCGACGGCGCTCACCTCTATCGCGCCAGCCCACGCTCTTCTGGAAGCGGCGGCGAACTCGGCTCAGCCACA
GCCTCGCGGGAGGTCATCCTCTCGGCCGGAACCTTTAACACGCCTCAGCTGCTCAAGCTCAGCGGCGTCGGCCCT
GCGGCTGAACTGGCGCGCTTCAACATCAGCCTCGTCCACGACGCGCCGGGCGTGGGCTCCAAGCTGCAGGACCAT
TACGAGGTGGCGGTTCAGGGCAGGGCGCCCACTAATTTCAACCTCTTACACGGCTGTACCTTTTCCGACGACGCC
GCCGACGATCCGTGCCTGAGCCGGTGGCAGACTCCCAACCGGCTCTCGCTCACGGGCCCCCGCGGCGTCTACTCG
TCCAGCGGCGCCCTCTCTTCCATGCTGGTGAGAACGGCGGCGGCGAGCGAGTACGACATCTTCATTTTTGGAGGA
CCCTTCGACTTCCGCGGCTACTATCCGGGCTTCAGCCGTGATCTCGTCGCCTCTTCCGACCTATGGTCCTGGATC
GTCCTCAAGGCTCACCCGCTCAACTCAGCCGGCACCGTGACGTTGCGATCCTCCGACCCGCTCGACGTGCCCGAC
GTCATCTTCAACTCCTTCGGCGACGACGAAGACGGAAGTACGGACCTGGGAGCCGTCCGTGAGGGCATCTCCGTC
GCCCGCGATGCCTTCCGTCGCCAACTCGTGCCCATGACCGAGAAGGTGCCCGGCGAGAAAGCCCAGTCGAAAGAA
TCGCTGGATGGGTACATCCGGGATAACGTCTTTGGCCACCACGCGACGTCGACGTGCGCCATCGGCGCGGATGAC
GACCCGATGGCCGTGCTGGACTCCAACTTTCGCGTCAGGGGCGTCAAGGGTCTTCGCGTCGTCGATGCTTCGGTT
TTTCCCCTCATCCCGGGCACGTTTCCGACTTTGGCCATCTACATGGTTGCCGAGAAGGCTGCTGATGTTATCCTG
GCGGGGAAATAG
Transcript >Ophcf2|01031
ATGCCAACTCCATCGCCTCTGCTCTCGCCCCTCGTCCTCGTGATCCTCCTCCTCTTCGCCGTCACCGCCTCGGCC
GTTGAACTATCGGGCTATGAATACATCGTGGTCGGCTCCGGCGCCGGCGGCGGTCCTCTCGCGGCACGGCTGGCG
ATGGCCGGCCGGCGGACGCTGCTAATCGAAGCCGGTACGGATCAAGGCGAGAATGTCAACACGACAGTACCAGCC
TACGCAACTCGCTCCAACGAGGACCCGGACATGTCATGGGACTTCTTTGTACGGCACTATAGCGACGATGAACAG
CAGGCTAGGGACCCGAAGACGACGTACCGCACGGCCGATGGCCAGCGCTACACGGGTCTGAAGCCGCCTCCTGGG
GCCAAGATGCTGGGCGTGCTGTATCCAAGGGCGGCCGCGCTCGGAGGTTGCTCCGTGCACAACGCGCTCATTTCT
GTCACGCCGCACCGGTCCGACTGGGACGATATTGCGAGACTGACGGGAGACTTGTCGTGGACGTCGGATCGCATG
CACGTATACTTCCGACGAGTGAATCGCGAGCAGCGTCCAAGCTTGTTCCGTCCGCCACCGCAGGATTCCCCTATC
GAAGGCGTCGGATGGCTATCGATTGAGAAGGCTCCCATTGGCATCCTCGCACGGGACCCTCTGTCGGCCAGCATC
CTCTTCGGCGGCGCCTTTGCCATGGGGAACCGGACGGGCGCGGTAAACACCATCGGAACCTTACTCACGGGCGAC
GCAAATGAGAACTCAGCCAAGCGCGATCGTGAAGGTGGTTACTATCAGACGCCACTGGCCGCTCACGAAGGAAAA
CGCATGTCGGCGCGGGACTTTGTCGTGGCCGTACGCGATGCTAAGACGGCTGAAGGCTCGCAACGCTTTCCGCTC
GACGTCCGCACCAACTGTCAGGTCACTCGCGTCATCTTCGATAAGGAACAGCCGCCTCGGGCCACGGGGGTAGAG
TTCCTCGACGGCGCTCACCTCTATCGCGCCAGCCCACGCTCTTCTGGAAGCGGCGGCGAACTCGGCTCAGCCACA
GCCTCGCGGGAGGTCATCCTCTCGGCCGGAACCTTTAACACGCCTCAGCTGCTCAAGCTCAGCGGCGTCGGCCCT
GCGGCTGAACTGGCGCGCTTCAACATCAGCCTCGTCCACGACGCGCCGGGCGTGGGCTCCAAGCTGCAGGACCAT
TACGAGGTGGCGGTTCAGGGCAGGGCGCCCACTAATTTCAACCTCTTACACGGCTGTACCTTTTCCGACGACGCC
GCCGACGATCCGTGCCTGAGCCGGTGGCAGACTCCCAACCGGCTCTCGCTCACGGGCCCCCGCGGCGTCTACTCG
TCCAGCGGCGCCCTCTCTTCCATGCTGGTGAGAACGGCGGCGGCGAGCGAGTACGACATCTTCATTTTTGGAGGA
CCCTTCGACTTCCGCGGCTACTATCCGGGCTTCAGCCGTGATCTCGTCGCCTCTTCCGACCTATGGTCCTGGATC
GTCCTCAAGGCTCACCCGCTCAACTCAGCCGGCACCGTGACGTTGCGATCCTCCGACCCGCTCGACGTGCCCGAC
GTCATCTTCAACTCCTTCGGCGACGACGAAGACGGAAGTACGGACCTGGGAGCCGTCCGTGAGGGCATCTCCGTC
GCCCGCGATGCCTTCCGTCGCCAACTCGTGCCCATGACCGAGAAGGTGCCCGGCGAGAAAGCCCAGTCGAAAGAA
TCGCTGGATGGGTACATCCGGGATAACGTCTTTGGCCACCACGCGACGTCGACGTGCGCCATCGGCGCGGATGAC
GACCCGATGGCCGTGCTGGACTCCAACTTTCGCGTCAGGGGCGTCAAGGGTCTTCGCGTCGTCGATGCTTCGGTT
TTTCCCCTCATCCCGGGCACGTTTCCGACTTTGGCCATCTACATGGTTGCCGAGAAGGCTGCTGATGTTATCCTG
GCGGGGAAATAG
Gene >Ophcf2|01031
ATGCCAACTCCATCGCCTCTGCTCTCGCCCCTCGTCCTCGTGATCCTCCTCCTCTTCGCCGTCACCGCCTCGGCC
GTTGAACTATCGGGCTATGAATACATCGTGGTCGGCTCCGGCGCCGGCGGCGGTCCTCTCGCGGCACGGCTGGCG
ATGGCCGGCCGGCGGACGCTGCTAATCGAAGCCGGTACGGATCAAGGCGAGAATGTCAACACGACAGTACCAGCC
TACGCAACTCGCTCCAACGAGGACCCGGACATGTCATGGGACTTCTTTGTACGGCACTATAGCGACGATGAACAG
CAGGCTAGGGACCCGAAGACGACGTACCGCACGGCCGATGGCCAGCGCTACACGGGTCTGAAGCCGCCTCCTGGG
GCCAAGATGCTGGGCGTGCTGTATCCAAGGGCGGCCGCGCTCGGAGGTTGCTCCGTGCACAACGCGCTCATTTCT
GTCACGCCGCACCGGTCCGACTGGGACGATATTGCGAGACTGACGGGAGACTTGTCGTGGACGTCGGATCGCATG
CACGTATACTTCCGACGAGTGAATCGCGAGCAGCGTCCAAGCTTGTTCCGTCCGCCACCGCAGGATTCCCCTATC
GAAGGCGTCGGATGGCTATCGATTGAGAAGGCTCCCATTGGCATCCTCGCACGGGACCCTCTGTCGGCCAGCATC
CTCTTCGGCGGCGCCTTTGCCATGGGGAACCGGACGGGCGCGGTAAACACCATCGGAACCTTACTCACGGGCGAC
GCAAATGAGAACTCAGCCAAGCGCGATCGTGAAGGTGGTTACTATCAGACGCCACTGGCCGCTCACGAAGGAAAA
CGCATGTCGGCGCGGGACTTTGTCGTGGCCGTACGCGATGCTAAGACGGCTGAAGGCTCGCAACGCTTTCCGCTC
GACGTCCGCACCAACTGTCAGGTCACTCGCGTCATCTTCGATAAGGAACAGCCGCCTCGGGCCACGGGGGTAGAG
TTCCTCGACGGCGCTCACCTCTATCGCGCCAGCCCACGCTCTTCTGGAAGCGGCGGCGAACTCGGCTCAGCCACA
GCCTCGCGGGAGGTCATCCTCTCGGCCGGAACCTTTAACACGCCTCAGCTGCTCAAGCTCAGCGGCGTCGGCCCT
GCGGCTGAACTGGCGCGCTTCAACATCAGCCTCGTCCACGACGCGCCGGGCGTGGGCTCCAAGCTGCAGGACCAT
TACGAGGTGGCGGTTCAGGGCAGGGCGCCCACTAATTTCAACCTCTTACACGGCTGTACCTTTTCCGACGACGCC
GCCGACGATCCGTGCCTGAGCCGGTGGCAGACTCCCAACCGGCTCTCGCTCACGGGCCCCCGCGGCGTCTACTCG
TCCAGCGGCGCCCTCTCTTCCATGCTGGTGAGAACGGCGGCGGCGAGCGAGTACGACATCTTCATTTTTGGAGGA
CCCTTCGACTTCCGCGGCTACTATCCGGGCTTCAGCCGTGATCTCGTCGCCTCTTCCGACCTATGGTCCTGGATC
GTCCTCAAGGCTCACCCGCTCAACTCAGCCGGCACCGTGACGTTGCGATCCTCCGACCCGCTCGACGTGCCCGAC
GTCATCTTCAACTCCTTCGGCGACGACGAAGACGGAAGTACGGACCTGGGAGCCGTCCGTGAGGGCATCTCCGTC
GCCCGCGATGCCTTCCGTCGCCAACTCGTGCCCATGACCGAGAAGGTGCCCGGCGAGAAAGCCCAGTCGAAAGAA
TCGCTGGATGGGTACATCCGGGATAACGTCTTTGGCCACCACGCGACGTCGACGTGCGCCATCGGCGCGGATGAC
GACCCGATGGCCGTGCTGGACTCCAACTTTCGCGTCAGGGGCGTCAAGGGTCTTCGCGTCGTCGATGCTTCGGTT
TTTCCCCTCATCCCGGGCACGTTTCCGACTTTGGCCATCTACATGGTTGCCGAGAAGGCTGCTGATGTTATCCTG
GCGGGGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail