Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01030
Gene name
Locationscaffold_01:3851879..3852542
Strand+
Gene length (bp)663
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01883 FeS_assembly_P Iron-sulfur cluster assembly protein 1.3E-09 72 158

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6976 0.4953 0.0149 0.0526 0.3921 0.0186 0.1079 0.0578 0.2148 0.0302

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4354
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2519
Ophiocordyceps australis map64 (Brazil) OphauB2|1537
Ophiocordyceps camponoti-floridani Ophcf2|01030 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6089
Ophiocordyceps kimflemingae Ophio5|4557
Ophiocordyceps subramaniannii Hirsu2|8955

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01030
MALDNANPTVLSASQLPTRHKAPGPRNGPDTRYDGLVLAAPPYLCRPWTGRRLAAWPPIVDQGHCTADPIDEQEV
YDLVSTISDPEHPVSLGQLSVINLSDIHITPSPALGLPSPNTIVRVSVDITPTITHCSLATVIGLAVRVRLEQAL
PPNYRVQVRCKENSHSQDEQVNKQLQDKERVAAALENDTLRGVLDKMLETCA*
Coding >Ophcf2|01030
ATGGCCCTCGACAACGCCAATCCTACCGTCCTCAGCGCCTCGCAGCTGCCCACGCGCCACAAGGCTCCCGGCCCT
CGTAACGGGCCCGATACCAGGTACGATGGCCTCGTCCTCGCCGCCCCGCCCTACCTGTGCCGCCCCTGGACCGGC
CGCCGCCTGGCCGCCTGGCCGCCTATCGTCGATCAAGGTCACTGCACCGCCGATCCCATCGACGAGCAGGAAGTC
TACGATCTCGTCTCTACCATATCAGATCCCGAGCACCCCGTCTCACTCGGCCAGCTCTCCGTCATCAACCTGTCC
GACATCCACATCACTCCGTCGCCGGCACTCGGCCTACCGTCCCCCAACACCATTGTCCGTGTCAGCGTCGACATA
ACGCCCACCATCACCCACTGTTCTCTCGCCACCGTCATCGGCCTGGCCGTACGTGTCCGTCTCGAGCAAGCCCTG
CCCCCCAACTACCGCGTCCAGGTACGGTGCAAGGAAAACAGCCACAGCCAGGACGAGCAGGTGAATAAGCAGCTC
CAAGATAAGGAGAGGGTCGCGGCCGCTCTCGAAAACGACACCCTACGCGGCGTCCTCGACAAGATGCTCGAGACG
TGCGCCTGA
Transcript >Ophcf2|01030
ATGGCCCTCGACAACGCCAATCCTACCGTCCTCAGCGCCTCGCAGCTGCCCACGCGCCACAAGGCTCCCGGCCCT
CGTAACGGGCCCGATACCAGGTACGATGGCCTCGTCCTCGCCGCCCCGCCCTACCTGTGCCGCCCCTGGACCGGC
CGCCGCCTGGCCGCCTGGCCGCCTATCGTCGATCAAGGTCACTGCACCGCCGATCCCATCGACGAGCAGGAAGTC
TACGATCTCGTCTCTACCATATCAGATCCCGAGCACCCCGTCTCACTCGGCCAGCTCTCCGTCATCAACCTGTCC
GACATCCACATCACTCCGTCGCCGGCACTCGGCCTACCGTCCCCCAACACCATTGTCCGTGTCAGCGTCGACATA
ACGCCCACCATCACCCACTGTTCTCTCGCCACCGTCATCGGCCTGGCCGTACGTGTCCGTCTCGAGCAAGCCCTG
CCCCCCAACTACCGCGTCCAGGTACGGTGCAAGGAAAACAGCCACAGCCAGGACGAGCAGGTGAATAAGCAGCTC
CAAGATAAGGAGAGGGTCGCGGCCGCTCTCGAAAACGACACCCTACGCGGCGTCCTCGACAAGATGCTCGAGACG
TGCGCCTGA
Gene >Ophcf2|01030
ATGGCCCTCGACAACGCCAATCCTACCGTCCTCAGCGCCTCGCAGCTGCCCACGCGCCACAAGGCTCCCGGCCCT
CGTAACGGGCCCGATACCAGGTACGATGGCCTCGTCCTCGCCGCCCCGCCCTACCTGTGCCGCCCCTGGACCGGC
CGCCGCCTGGCCGCCTGGCCGCCTATCGTCGATCAAGGTCACTGCACCGCCGATCCCATCGACGAGCAGGAAGTC
TACGGTGAGTCGTCAACGTCTTACTCTTTGGTCGTTCCGGCTCCTGATTAGCTGCAAGATCTCGTCTCTACCATA
TCAGATCCCGAGCACCCCGTCTCACTCGGCCAGCTCTCCGTCATCAACCTGTCCGACATCCACATCACTCCGTCG
CCGGCACTCGGCCTACCGTCCCCCAACACCATTGTCCGTGTCAGCGTCGACATAACGCCCACCATCACCCACTGT
TCTCTCGCCACCGTCATCGGCCTGGCCGTACGTGTCCGTCTCGAGCAAGCCCTGCCCCCCAACTACCGCGTCCAG
GTACGGTGCAAGGAAAACAGCCACAGCCAGGACGAGCAGGTGAATAAGCAGCTCCAAGATAAGGAGAGGGTCGCG
GCCGCTCTCGAAAACGACACCCTACGCGGCGTCCTCGACAAGATGCTCGAGACGTGCGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail