Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01024
Gene name
Locationscaffold_01:3832439..3833243
Strand-
Gene length (bp)804
Transcript length (bp)804
Coding sequence length (bp)804
Protein length (aa) 268

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06229 FRG1 FRG1-like domain 1.9E-45 85 266

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4132 0.8862 0.1276 0.0299 0.0536 0.0134 0.0432 0.0125 0.0276 0.0008

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2799
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5567
Ophiocordyceps australis map64 (Brazil) OphauB2|369
Ophiocordyceps camponoti-floridani Ophcf2|01024 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6649
Ophiocordyceps kimflemingae Ophio5|5118
Ophiocordyceps subramaniannii Hirsu2|4484

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01024
MVKPLTFKGDKKPKKRKRVDDKDTPRAAKHHHHNQSDEEAALDDDSWVSAEAVTDVIGPVIIVLPTDTPSALACD
AGGAVFAMGLENVVDGNPATAEPHDVRQVWVANRVSGTESFRFKSHHGRYLSCDVTGRLSAMSEAVSPLESFNVI
ATADTPGTFQLQTLRDTLLTLRPAPKASVGAEVRGDADVIAFDTTFRIRLQARFKPRLRASKEERALAKISRKEL
EEAAGRRLSEDEVKLLKRARREGDYHEKLLDIKVKGKHDKFA*
Coding >Ophcf2|01024
ATGGTGAAGCCGCTGACATTCAAAGGCGATAAAAAGCCCAAGAAGCGGAAACGCGTCGACGACAAAGATACCCCC
CGCGCCGCCAAACACCACCACCACAATCAGTCTGACGAAGAGGCCGCCCTCGACGACGACAGCTGGGTCTCAGCC
GAAGCCGTAACCGACGTCATCGGCCCCGTCATCATCGTCCTCCCTACAGACACGCCATCGGCTTTAGCCTGCGAT
GCTGGCGGCGCCGTCTTCGCCATGGGTCTCGAGAACGTGGTCGACGGCAATCCCGCCACCGCCGAGCCCCACGAT
GTGCGCCAGGTTTGGGTCGCCAACCGCGTGTCGGGCACCGAGAGCTTCCGCTTCAAGAGCCATCACGGTCGCTAT
CTCTCGTGCGATGTCACCGGTCGCCTGTCGGCTATGTCCGAGGCCGTCTCGCCGCTTGAGAGCTTCAATGTCATC
GCCACCGCTGATACCCCGGGTACTTTCCAGCTGCAGACGCTGCGCGACACGCTCCTCACTCTCAGGCCCGCGCCC
AAGGCTAGCGTCGGCGCCGAGGTGCGCGGCGATGCAGACGTCATCGCCTTTGACACTACTTTCCGCATCCGCCTG
CAGGCCCGCTTCAAACCGAGACTGAGGGCGTCTAAGGAGGAGCGCGCTCTGGCCAAAATCTCCCGCAAGGAGCTA
GAGGAGGCTGCTGGTCGCAGGCTGTCCGAGGACGAGGTCAAGCTGCTGAAGCGCGCCAGGAGGGAAGGCGACTAT
CACGAAAAGTTACTCGACATCAAGGTCAAGGGCAAGCACGACAAATTTGCCTGA
Transcript >Ophcf2|01024
ATGGTGAAGCCGCTGACATTCAAAGGCGATAAAAAGCCCAAGAAGCGGAAACGCGTCGACGACAAAGATACCCCC
CGCGCCGCCAAACACCACCACCACAATCAGTCTGACGAAGAGGCCGCCCTCGACGACGACAGCTGGGTCTCAGCC
GAAGCCGTAACCGACGTCATCGGCCCCGTCATCATCGTCCTCCCTACAGACACGCCATCGGCTTTAGCCTGCGAT
GCTGGCGGCGCCGTCTTCGCCATGGGTCTCGAGAACGTGGTCGACGGCAATCCCGCCACCGCCGAGCCCCACGAT
GTGCGCCAGGTTTGGGTCGCCAACCGCGTGTCGGGCACCGAGAGCTTCCGCTTCAAGAGCCATCACGGTCGCTAT
CTCTCGTGCGATGTCACCGGTCGCCTGTCGGCTATGTCCGAGGCCGTCTCGCCGCTTGAGAGCTTCAATGTCATC
GCCACCGCTGATACCCCGGGTACTTTCCAGCTGCAGACGCTGCGCGACACGCTCCTCACTCTCAGGCCCGCGCCC
AAGGCTAGCGTCGGCGCCGAGGTGCGCGGCGATGCAGACGTCATCGCCTTTGACACTACTTTCCGCATCCGCCTG
CAGGCCCGCTTCAAACCGAGACTGAGGGCGTCTAAGGAGGAGCGCGCTCTGGCCAAAATCTCCCGCAAGGAGCTA
GAGGAGGCTGCTGGTCGCAGGCTGTCCGAGGACGAGGTCAAGCTGCTGAAGCGCGCCAGGAGGGAAGGCGACTAT
CACGAAAAGTTACTCGACATCAAGGTCAAGGGCAAGCACGACAAATTTGCCTGA
Gene >Ophcf2|01024
ATGGTGAAGCCGCTGACATTCAAAGGCGATAAAAAGCCCAAGAAGCGGAAACGCGTCGACGACAAAGATACCCCC
CGCGCCGCCAAACACCACCACCACAATCAGTCTGACGAAGAGGCCGCCCTCGACGACGACAGCTGGGTCTCAGCC
GAAGCCGTAACCGACGTCATCGGCCCCGTCATCATCGTCCTCCCTACAGACACGCCATCGGCTTTAGCCTGCGAT
GCTGGCGGCGCCGTCTTCGCCATGGGTCTCGAGAACGTGGTCGACGGCAATCCCGCCACCGCCGAGCCCCACGAT
GTGCGCCAGGTTTGGGTCGCCAACCGCGTGTCGGGCACCGAGAGCTTCCGCTTCAAGAGCCATCACGGTCGCTAT
CTCTCGTGCGATGTCACCGGTCGCCTGTCGGCTATGTCCGAGGCCGTCTCGCCGCTTGAGAGCTTCAATGTCATC
GCCACCGCTGATACCCCGGGTACTTTCCAGCTGCAGACGCTGCGCGACACGCTCCTCACTCTCAGGCCCGCGCCC
AAGGCTAGCGTCGGCGCCGAGGTGCGCGGCGATGCAGACGTCATCGCCTTTGACACTACTTTCCGCATCCGCCTG
CAGGCCCGCTTCAAACCGAGACTGAGGGCGTCTAAGGAGGAGCGCGCTCTGGCCAAAATCTCCCGCAAGGAGCTA
GAGGAGGCTGCTGGTCGCAGGCTGTCCGAGGACGAGGTCAAGCTGCTGAAGCGCGCCAGGAGGGAAGGCGACTAT
CACGAAAAGTTACTCGACATCAAGGTCAAGGGCAAGCACGACAAATTTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail