Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|01017
Gene name
Locationscaffold_01:3819411..3820399
Strand-
Gene length (bp)988
Transcript length (bp)915
Coding sequence length (bp)915
Protein length (aa) 305

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 98 120 22
3 141 163 22
4 204 223 19
5 244 266 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|01017
MGRHGCSFGPGPGPWDPDRRLETSCLMGPLLLSVCRAVMSLYAFVTVIFVIGYSCALPRSTPPESSITTTNTTTP
SQPSTLDSATTGCTSVAHSFSYFTVLSYWGLAFYFLVAALHSLSYARSAQQSLLARLPRPLQALHSLFYSSVVVF
PLVVSIVFWAVLHRGWFSSAFDAWRNISQHALNSAFALFEIIVPRTEPLPWSHLLWLAVILLAYLALAFITLAHQ
GFYTYAFLDYHRVGGRGQVAGYILGITAALVIIFCAVHFLIRFRRWLTETKLGLDAQHARPPVPVADMESADVEA
KASG*
Coding >Ophcf2|01017
ATGGGTCGCCATGGCTGCTCCTTCGGCCCCGGACCCGGCCCTTGGGACCCGGATCGTCGGTTAGAGACTTCGTGC
CTGATGGGGCCGCTTCTACTATCCGTCTGTCGAGCTGTCATGTCCCTCTACGCCTTTGTCACCGTCATCTTCGTC
ATCGGATACTCTTGCGCCTTGCCTCGGTCCACGCCCCCCGAATCCAGCATCACCACCACCAATACCACAACTCCC
TCTCAACCGTCAACCCTAGACTCCGCCACCACCGGCTGCACCTCGGTCGCCCACTCCTTTTCCTACTTCACCGTC
CTCTCCTACTGGGGCCTCGCCTTTTACTTCCTCGTCGCCGCCCTCCACTCCCTGTCCTACGCCCGCTCAGCTCAA
CAGTCGCTCCTCGCCCGCCTCCCTCGACCGCTACAGGCCCTACACTCTCTCTTCTACTCGTCCGTCGTCGTCTTC
CCACTGGTCGTCTCCATCGTCTTCTGGGCCGTCCTTCACCGCGGCTGGTTCTCCTCCGCCTTCGACGCCTGGCGC
AACATCAGCCAACACGCCCTCAACTCGGCCTTTGCCCTTTTCGAGATCATCGTGCCCCGTACCGAGCCCTTGCCC
TGGTCACATCTTCTCTGGCTCGCCGTCATCCTCCTCGCTTACCTCGCCCTCGCATTCATCACTCTGGCTCATCAG
GGCTTCTACACCTACGCTTTTCTCGACTACCATCGCGTCGGCGGCCGCGGTCAAGTCGCAGGCTATATCCTGGGC
ATCACCGCCGCCCTCGTCATCATCTTCTGCGCCGTTCACTTCCTCATCCGCTTCCGAAGATGGCTGACCGAGACC
AAGCTCGGCCTCGACGCCCAGCACGCCCGCCCTCCGGTCCCGGTTGCCGACATGGAGAGTGCCGACGTTGAGGCC
AAGGCATCGGGATGA
Transcript >Ophcf2|01017
ATGGGTCGCCATGGCTGCTCCTTCGGCCCCGGACCCGGCCCTTGGGACCCGGATCGTCGGTTAGAGACTTCGTGC
CTGATGGGGCCGCTTCTACTATCCGTCTGTCGAGCTGTCATGTCCCTCTACGCCTTTGTCACCGTCATCTTCGTC
ATCGGATACTCTTGCGCCTTGCCTCGGTCCACGCCCCCCGAATCCAGCATCACCACCACCAATACCACAACTCCC
TCTCAACCGTCAACCCTAGACTCCGCCACCACCGGCTGCACCTCGGTCGCCCACTCCTTTTCCTACTTCACCGTC
CTCTCCTACTGGGGCCTCGCCTTTTACTTCCTCGTCGCCGCCCTCCACTCCCTGTCCTACGCCCGCTCAGCTCAA
CAGTCGCTCCTCGCCCGCCTCCCTCGACCGCTACAGGCCCTACACTCTCTCTTCTACTCGTCCGTCGTCGTCTTC
CCACTGGTCGTCTCCATCGTCTTCTGGGCCGTCCTTCACCGCGGCTGGTTCTCCTCCGCCTTCGACGCCTGGCGC
AACATCAGCCAACACGCCCTCAACTCGGCCTTTGCCCTTTTCGAGATCATCGTGCCCCGTACCGAGCCCTTGCCC
TGGTCACATCTTCTCTGGCTCGCCGTCATCCTCCTCGCTTACCTCGCCCTCGCATTCATCACTCTGGCTCATCAG
GGCTTCTACACCTACGCTTTTCTCGACTACCATCGCGTCGGCGGCCGCGGTCAAGTCGCAGGCTATATCCTGGGC
ATCACCGCCGCCCTCGTCATCATCTTCTGCGCCGTTCACTTCCTCATCCGCTTCCGAAGATGGCTGACCGAGACC
AAGCTCGGCCTCGACGCCCAGCACGCCCGCCCTCCGGTCCCGGTTGCCGACATGGAGAGTGCCGACGTTGAGGCC
AAGGCATCGGGATGA
Gene >Ophcf2|01017
ATGGGTCGCCATGGCTGCTCCTTCGGCCCCGGACCCGGCCCTTGGGACCCGGATCGTCGGTTAGAGACTTCGTGC
CTGATGGGGCCGCTTCTACTATCCGTCTGTCGAGCTGTCATGGTCCGTATACAGAAGCTTCCGTCTATCGAGACC
GAAACCCACCTTGGTGTTACCAGCTGACGGCCCTACGCAGTCCCTCTACGCCTTTGTCACCGTCATCTTCGTCAT
CGGATACTCTTGCGCCTTGCCTCGGTCCACGCCCCCCGAATCCAGCATCACCACCACCAATACCACAACTCCCTC
TCAACCGTCAACCCTAGACTCCGCCACCACCGGCTGCACCTCGGTCGCCCACTCCTTTTCCTACTTCACCGTCCT
CTCCTACTGGGGCCTCGCCTTTTACTTCCTCGTCGCCGCCCTCCACTCCCTGTCCTACGCCCGCTCAGCTCAACA
GTCGCTCCTCGCCCGCCTCCCTCGACCGCTACAGGCCCTACACTCTCTCTTCTACTCGTCCGTCGTCGTCTTCCC
ACTGGTCGTCTCCATCGTCTTCTGGGCCGTCCTTCACCGCGGCTGGTTCTCCTCCGCCTTCGACGCCTGGCGCAA
CATCAGCCAACACGCCCTCAACTCGGCCTTTGCCCTTTTCGAGATCATCGTGCCCCGTACCGAGCCCTTGCCCTG
GTCACATCTTCTCTGGCTCGCCGTCATCCTCCTCGCTTACCTCGCCCTCGCATTCATCACTCTGGCTCATCAGGG
CTTCTACACCTACGCTTTTCTCGACTACCATCGCGTCGGCGGCCGCGGTCAAGTCGCAGGCTATATCCTGGGCAT
CACCGCCGCCCTCGTCATCATCTTCTGCGCCGTTCACTTCCTCATCCGCTTCCGAAGATGGCTGACCGAGACCAA
GCTCGGCCTCGACGCCCAGCACGCCCGCCCTCCGGTCCCGGTTGCCGACATGGAGAGTGCCGACGTTGAGGCCAA
GGCATCGGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail